KEGG   Paramormyrops kingsleyae: 111843125
Entry
111843125         CDS       T05788                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04020  Calcium signaling pathway
pki04260  Cardiac muscle contraction
pki04261  Adrenergic signaling in cardiomyocytes
pki04270  Vascular smooth muscle contraction
pki04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111843125 (cacna1c)
   04020 Calcium signaling pathway
    111843125 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111843125 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111843125 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    111843125 (cacna1c)
   04270 Vascular smooth muscle contraction
    111843125 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pki04040]
    111843125 (cacna1c)
Ion channels [BR:pki04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111843125 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1 DUF4834
Other DBs
NCBI-GeneID: 111843125
NCBI-ProteinID: XP_023666173
LinkDB
Position
Unknown
AA seq 2315 aa
MDNCLNFCLHFYTGCHRVSDAKEITQYLQEVGHHEQKQRDLKTTKITPKQATLRVFQKTM
FHRLFHRKQKHERLEEEPDVKFRGKLISETQLECTYVRPGGSNYSSPSLAAPPSLNDRDH
AVVGLAPEHIATPGAALSWQAAIDAARQAKLMGNAAAPISTASSTQRKRQHYSKPKKQAS
TAVTRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNA
TNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQ
ATKEAGGTPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALL
VLFVIIIYAIIGLELFMGKMHRTCFHHRDGKLGHLLEERPEPCAPQHANGRHCNPQNTTK
CESGWDGPNNGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIF
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EEEGLDEDKPRNRVTLADLLDKKRGKFAWFSHSSETHGKHPRHVCLCAAVSAGPDADPFC
RFVDFQWAVLCLLNRISKSKFSRYSRRWNRLCRRKSRAAVKSNVFYWLVIFLVFLNTLTI
ASEHHKQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGIL
ETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPS
FPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTAS
PEKRPENEKQPIEEEHKEEKIELKSITSDGETPTATKIIIDEYQGDENEEKNPYPANDFP
GDEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRLLCHKIVNHNIFT
NLILFFILLSSISLAAEDPVKNDSFRNQILGYADYVFTGLFTIEIILKMTAYGAFLHKGS
FCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVF
VAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFYSCTDNSKQTEGECKGTYILYKDGDVAK
PEKATRIWENSEFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDIGPIYNYRVVIS
IFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYI
PKNPYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHHGQSPSFNKAMNVLNMLFTGLFT
VEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSI
VDIAITEVNPADSTSSSQSPMVRSMVSQNGEDNARISITFFRLFRVMRLVKLLSRGEGIR
TLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDTSQINRNNNFQTFPQAVL
LLFRCATGEAWQDIMLACSPNKPCENGSEVGMPNDDCGSHFAIIYFVTFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALS
LQAGLRTLHDMGPEIRRAISGDLTVEEELEKAMKETVCAASEDDIFRRAGGLFGNHVNYY
HQSDGRNTFPQSFTTQRPLHLSKSGSPGDGESPSHEKLVDSTFTPSSYSSSGSNANINNA
NNTNVGRFPGSSISTVDGHRGQSVTPTLLPRPSWHFPSKSSDSSDSRLPIIRREDASVDE
TYDESFVDEREYCSDQSMLSAEMLAYQDEESKQLAPMEEGEDASDRRAWPSPRRAFLCPT
ALARRSSFHLECLKRQARADVSQRTALPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCS
TPPDSPSLRAGRGGAYQRVPALHLEADGSYEKLNSSLPSVNCGPWYSDGDGVQPGRRSLR
PASLTVPPTAGRDSLCRGSAGSLVEAVLISEGLGHYAQDPSFIEVTKQELADACDMTIEE
MESAADSILNSNSQPSSNGGLPPFMHCRDHSTERPVQTEGPPGAMSGQKGEEPRAHLMGE
EEAEEQEGEGPLAADSRSRDFGFLDDEDMDCVTSL
NT seq 6948 nt   +upstreamnt  +downstreamnt
atggataactgtctaaatttctgtctacatttttacacagggtgccacagagtctcagat
gccaaagaaataacacagtaccttcaggaagtgggtcaccatgaacagaagcagcgagat
ttaaaaaccacgaaaataacaccaaagcaggccaccttaagggtcttccagaagaccatg
ttccaccggttgtttcaccgcaagcagaagcacgagcgcctggaagaggagcccgatgtg
aaattcagagggaagctcatttcggagacccaacttgaatgcacatatgtgcggcccgga
ggctccaactactcgagcccctccctcgcggccccgcccagcctaaacgaccgcgaccat
gcggtggtgggactggccccggagcacatcgccacgcctggagcggcgctctcctggcag
gcggccattgacgccgcgcggcaggccaagctgatgggcaatgcggccgcccccatctcc
acggccagctccacccagcgcaagcggcagcactacagcaaacccaagaagcaggccagc
acggccgtcacccggcccccacgcgccctgctctgcctcaccctcaagaaccccatccga
cgagcctgcatcagcatcgtggagtggaaaccctttgaaatcatcattttgctgactatt
tttgcaaactgcgtggccttagctatctacatccccttccccgaagatgactccaacgcc
acaaactccaacctggaacgggttgagtatctcttcctcatcatcttcaccgtggaagcg
tttctgaaggtcatagcctacgggctgctcttccacccgaatgcgtatctgcgtaacgga
tggaaccttctggatttcatcatcgtagtcgtagggctttttagtgccattttggaacaa
gccaccaaagaggcggggggcacgcccatcggtgggaaggcggcgggcttcgacgtgaag
gcgctgcgggcattccgggtgctccggcccctgagacttgtgtccggcgtgcccagcctc
caggtggtgctcaactccatcatcaaagccatggttcccctactgcacattgccctcctt
gtcctcttcgtcatcatcatctatgccatcatcggcctggagctgtttatgggcaagatg
catcgcacctgcttccaccaccgggacgggaagctgggtcatctgttggaggagagaccc
gaaccatgcgccccccagcacgccaacgggaggcactgcaacccccagaacaccacaaag
tgcgagtcgggctgggatggacccaacaacggcatcaccaactttgacaactttgccttt
gcgatgctgactgtctttcagtgcatcaccatggagggctggactgacgtgctgtactgg
atgcaggacgctatgggctatgagcttccctgggtgtattttgtcagtctggtcatcttc
ggatcctttttcgtactaaatctggttctgggggtgttgagcggcgagttctccaaggag
cgagagaaggccaaggctcggggcgacttccagaagctgagagagaaacagcagctggag
gaggacctgaagggctacctggactggatcacccaggctgaagacatcgaccctgagaat
gaagaagaggggctggatgaggacaagcccaggaaccgagtcaccttggccgacttgctt
gacaagaagagggggaagtttgcttggtttagtcactccagtgagacccatggtaaacac
ccacgtcatgtgtgtctgtgtgctgctgtgtcggcggggcctgatgcagaccccttctgt
cgctttgttgacttccagtgggccgtcctgtgtcttctaaataggatctccaaatccaag
ttcagccggtattcgcggcgttggaaccgcctgtgccggagaaagagccgagcggcggtg
aagtccaacgtcttctactggctggtgatctttctggtcttcctcaacacgctgaccatt
gcctcggagcaccacaagcagccccagtggctcacggatgtgcaagacatcgccaacaag
gtgctgctggctctgttcacgggcgagatgctgctgaagatgtacagcctgggcctgcag
gcctacttcgtgtccctcttcaaccgcttcgacagcttcgtggtgtgcggtggcatcctg
gagaccatcttggtggagacgaagatcatgtccccgctgggcatttcagtcctgcgctgt
gtgcgcctcctgcgcatcttcaagatcaccaggtactggaattccttgagcaacctggta
gcctcgctgctcaactcagtgcggtccatcgcctccctcctgcttctgctcttcctcttc
atcatcatcttctctctgctgggcatgcagctgttcggggggaagttcaactttgacgag
acccgccgcagcaccttcgataacttcccccagtcactgctcactgtgtttcagatcctg
acaggcgaggattggaactcagtgatgtatgatggaattatggcatatgggggcccatcc
ttcccaggaatgctggtctgcatctacttcatcatcctcttcatctgtggaaactatatc
ctgctgaatgtcttcttggccattgctgtggacaatcttgcagatgctgagagcttgacg
tcagcccagaaggaggaagaggaggagaaggaaaggaaaaagctggccagaactgccagc
ccagaaaagcggccagaaaatgaaaagcaaccgattgaggaagagcataaggaggagaag
attgagctgaaatccatcacttcagatggagagacacccacggccaccaagatcatcata
gatgaataccaaggtgatgagaacgaagagaagaacccatatcctgctaacgattttcca
ggtgatgaagatgatgaggagccagagatgccggtgggaccccggccccggccgctgtcg
gacatccagctgaaggagaaggcagttcccatgccagaggctcgagccttcttcatcttt
agccacaccaacaagttcaggttactgtgccacaagattgtcaaccacaacatcttcacc
aacctcatcctcttcttcattctgctgagcagcatttcactggctgcagaagaccccgtg
aagaacgactcctttaggaatcagatactaggttatgctgattatgtcttcacgggactg
tttaccatcgaaatcatactgaagatgacagcctacggggccttccttcacaaaggctcc
ttctgccgcaactacttcaacatcctggacctggtggtggtcagtgtgtccctcatctcc
tctgggattcagtcaagtgccattaatgtagtgaagatcctcagggtgctgcgggtgctg
aggcctttaagggccattaatcgagccaagggcctgaagcacgtggtccagtgtgtcttc
gtggcgatccgcaccattgggaacattgtcatcgtcacctcgctcctgcagttcatgttt
gcctgcattggagtgcagctgttcaagggcaagttctacagctgcaccgacaattccaaa
caaacagaaggggaatgcaagggtacctacatcctctacaaggacggggacgtggccaaa
ccggagaaggcgacgaggatctgggagaacagcgagttcaactttgacgacgtgctccag
ggcatgatggcgctgttcgcggtctcgactttcgagggctggccagggctgctgtaccgg
gccatagactcccatgcagaggacattgggccgatctacaactaccgcgtggtgatctcc
atcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatcttcgtcggt
ttcgtcattgtcaccttccaggagcaaggggagcaggaatacaagaactgtgaactggac
aagaaccagcgccaatgtgtggaatatgcactcaaagcccgcccactgcggaggtacatc
ccgaagaacccatatcagtacaaggtgtggtacgtggtgaactccacctacttcgagtat
ctgatgttcgtcctcattctgctcaacaccatctgcctggccatgcagcaccacggccag
tccccctccttcaacaaggccatgaatgtgctgaacatgcttttcactggcctgttcacc
gtggagatgattctcaagctcatcgccttcaagccacggggttactttagtgatccttgg
aatgtttttgacttcctcatcgtaattggcagcataatagacgtcattctgagtgagatc
aatcattattttgttgatgcatggaacacatttgacgccttaatagttgtgggtagcatt
gtcgatatagctatcactgaggttaacccagctgactccacctcgtcttcccaatccccc
atggtaagatcaatggtatcacaaaacggagaagacaatgccaggatctccatcactttt
ttccggctcttccgtgtcatgaggctggtgaagctgctgtctcggggtgaaggtatccgg
accctgctctggaccttcatcaagtcctttcaagccctgccttatgtagccctgttaatc
gtgatgctgttctttatctatgctgtaattggaatgcagatgtttggtaagatcgccctg
cgggacaccagccagatcaaccgcaacaacaacttccagacgttccctcaggccgtcctc
ctgcttttcaggtgtgcaacaggggaggcctggcaggatatcatgcttgcatgcagcccc
aataagccttgtgagaatggatcagaggtggggatgcccaatgacgactgtggcagccat
ttcgccatcatctactttgtcaccttctacatgctgtgtgccttcctgatcattaatctg
tttgtggccgtcatcatggataactttgactacctgacccgagactggtccattctgggc
ccgcaccacctcgacgagttcaagaggatctgggccgagtatgaccctgaggccaagggg
aggatcaaacacctggatgtggtgacgctgctgcgccggattcagcctcctctgggcttc
ggcaagctgtgcccccaccgtgtggcctgcaagcggctggtgtccatgaacatgccactg
aacagcgacgggacggttatgtttaatgccaccctgttcgcccttgtcaggacggcactg
cgcatcaagacagaaggtaatttggagcaagcaaatgaggagctacgggcaattgtgaag
aagatctggaaaaggaccagcatgaagctactggaccaggtggttccgcctgcaggagat
gacgaggtcaccgtggggaaattctatgccaccttcttgatccaggagtatttcagaaag
ttcaagaagcgcaaagagcagggcctggtggcaaaagtgccaccaaagaccgccctctcc
cttcaggcagggctgcggacgcttcacgacatggggccggagattcgcagggctatctca
ggggacctgacggtggaggaggagctggagaaggccatgaaggagacagtgtgcgctgcc
tcggaggatgacatcttcaggcgagcgggcggcctcttcggcaaccacgtcaactactac
caccagagcgacgggcgcaacaccttcccgcagtcgttcaccacgcagcggccccttcac
ctcagcaagtcgggcagccccggagatggcgagtcgccgtcccacgagaagctagtggac
tccaccttcacgcccagcagctactcctcgtctggctctaacgccaacatcaataacgcc
aacaacaccaacgtcggccgcttccccggctcgtccatcagtaccgtggacgggcaccgt
gggcagtccgtgacgcccacgctgctaccccgtccttcttggcacttcccttccaagagt
tcggactccagcgacagtcgcttgcccatcattcgtagggaggacgcgtccgtcgatgaa
acgtacgacgagagcttcgtggacgagagggagtactgcagcgaccagagcatgctctcc
gctgaaatgctggcatatcaggatgaggagagcaagcagctggctcccatggaggaaggc
gaggatgccagcgaccggcgcgcctggccatcccccagaagggctttcctgtgtcccact
gcattagcccgacggtcttccttccacctggagtgtcttaaacggcaggcaagagcggat
gtttcccagaggaccgcactgcccctgcacctcgttcaccatcaggccctggctgtggcc
ggcctgagccctctcctccgaaggagccactccccgacgctcttcagccggctgtgctcc
acgccccccgacagccccagcctgcgggccggccgggggggtgcgtaccagcgcgtgccc
gccctgcacctggaggctgacggctcctacgagaagctcaacagcagcctgccctcggtg
aactgcggcccgtggtacagcgacggtgatggcgtgcagcccggccggcgctcactgcgg
cccgcctccctgactgtgccccccactgcgggcagggactcgctgtgtcgcggcagcgct
ggcagcctggtggaggcggtgctgatatcagagggccttggccactacgcacaggacccc
tccttcatcgaggtgaccaagcaggagctggccgacgcctgcgacatgaccatcgaggag
atggagagtgctgcagacagcatcctcaacagcaacagccagcccagctccaacgggggc
ctcccacccttcatgcactgcagggaccacagcacagaacggcccgtccagaccgagggg
cccccaggggcaatgagtgggcaaaagggggaggagcctagggcccaccttatgggggag
gaggaggcggaagagcaggaaggggagggtcctctggcggctgactcacggtcgcgggat
tttgggttcttggacgacgaggacatggactgcgtcaccagtttgtag

DBGET integrated database retrieval system