KEGG   Paramormyrops kingsleyae: 111844683
Entry
111844683         CDS       T05788                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04012  ErbB signaling pathway
pki04068  FoxO signaling pathway
pki04110  Cell cycle
pki04115  p53 signaling pathway
pki04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111844683
   04068 FoxO signaling pathway
    111844683
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111844683
   04115 p53 signaling pathway
    111844683
   04218 Cellular senescence
    111844683
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111844683
NCBI-ProteinID: XP_023669140
Ensembl: ENSPKIG00000004968
LinkDB
Position
Unknown
AA seq 155 aa
MTSLDQGTSMSNEKNFPVAHGKGRARRRLFGPVDHELLQVEYQNALNRELEDARYRWGFD
FLTETPLEGSDFIWEGVSGSKLPLLYRPSKIPQETGLNSKKNIPRTPERYISLTLALEQT
PEKNQAGKTKRKQSSITDFYKSKRRMVATPRKSGQ
NT seq 468 nt   +upstreamnt  +downstreamnt
atgacttcactggatcagggcacatccatgtcgaacgagaagaatttcccagtggctcac
gggaagggacgggcacggcggcggcttttcgggcctgtagaccatgaactgctccaagtg
gagtaccagaacgccctgaatagggaactggaggatgctagataccgctggggttttgac
ttccttactgagactcctttggaggggagtgacttcatctgggagggggtctcagggtca
aagcttcccttactgtaccgcccatccaagattccccaagaaactggcttgaacagcaag
aaaaacatacctcgcactccagagaggtacatctccctgaccctggccctggaacagaca
cccgagaagaaccaggctggcaagacgaagaggaagcagagcagcattacagatttctac
aagtctaagcgccgtatggtggccacgcccaggaagtcagggcagtga

DBGET integrated database retrieval system