KEGG   Paramormyrops kingsleyae: 111845037Help
Entry
111845037         CDS       T05788                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111845037
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111845037
Protein kinases [BR:pki01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111845037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 111845037
NCBI-ProteinID: XP_023669860
Ensembl: ENSPKIG00000021340
LinkDB All DBs
Position
Unknown
AA seq 716 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGSGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRQLTEDVSSLTEVSSVYIVQEYMETDLCKLLE
QGLLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVIHEEDRQELQSVIPVFVRKDMSVPQTPLAKLLPGASKEALDFLGKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPIANHPFHIEDEVDDILLMDETHSQVYNTWDRYHD
SQFSDQDWHLHSTHEADNVQLDPRAMSEVTDEEEVRVDPRKYQDGDREKFQDDPVFDSFF
ASEFSWQAEEHHENKYCDLECGHTCNYKAVSPSYLDNLVWRDSEVNHYYEPKLIIDLSNW
KEQSKEKADKKGKSKCEKNGLVKAQIALEEASQDPAEKDKQQEKHQGFDFDSFIAGTIKL
SLQPDSCEVGLLNELNSSVSQLETKSPVPKSISQEKEEKCLVNLAQLEGRTPQPWESFSC
ADITGEESCLIDEVCWDVRKDEQLQKETTCTSYLDRLFSKKEEAQEPAAVEVDEGFVTRN
GELVFNVQLDSLAVPRFESPADSPLKSIQTTLTPSAIKCSPQIAHKTYSSILKHLN
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagtttgaaagtctcatgaacatccatggcttcgatctgggcccccgttac
atggaccttaagcctttgggctacggcggcagcggcctggtcttctccgccgtggacaat
gactgtgacaagcgggtggcggttaagaagatcgtgctcaccgacccccagagcgtgaag
cacgccctgagggagatcaagatcatccggcgtctggaccacgacaacatcgtgaaggtt
tttgagacgcttggccccagtggccggcagctgacagaggacgtgagctccctgacggag
gtcagctcggtctacatcgtgcaggagtacatggagacagacctgtgcaagcttctagag
caggggctgctgtctgagggtcacgcacggctcttcatgtaccagctgctgaggggcctg
aagtacatccactccgccaatgttctgcacagggacctcaaacctgccaacctctttgtc
aacacagaggaccttgtcctgaagatcggggacttcggcctcgccagaatcatggatcca
cactattcacacaagggtcatctctctgaaggactggtcacaaagtggtaccgatctccc
cgactcctgctgtctccaaacaactataccaaagccatcgatatgtgggctgccggctgc
atctttgccgaaatgctgacgggaaagacgctctttgcaggtgcccacgagctggagcag
atgcagctgatcctggagtccatccctgtgatccatgaggaggaccgacaggagttgcag
agcgtcatccctgtttttgtccgcaaggacatgtccgtgccccagactccgctggccaag
ctgcttcccggggccagcaaggaggctttggacttcttggggaaaatcttgactttcaat
cccatggaccgccttacggctgaagaggccttagcccacccctacatgagtgactactcc
ttcccgctagacgagcccatcgccaaccaccccttccatattgaggatgaggtggatgac
atcttgctaatggatgagacccacagtcaagtgtacaacacctgggacagatatcatgac
agtcagttctcagaccaagactggcatctgcatagtactcatgaagcagacaatgtccag
ctggacccccgagccatgtcagaagtgactgacgaagaggaggttcgggttgacccgcgc
aagtaccaggatggggaccgggagaaatttcaggacgacccagtgtttgattccttcttt
gcctcagagttctcttggcaggcagaagagcaccacgaaaacaaatattgcgacctggaa
tgtggacacacctgcaactacaaagctgtctctccctcatacctggataacttggtgtgg
cgtgacagtgaggtcaaccattactacgagcccaagctcatcattgacctgtccaactgg
aaggaacagagtaaagaaaaggcagacaagaagggaaagtccaaatgcgagaaaaacggc
ttggtcaaggcccaaattgcgcttgaggaagcttctcaggatcctgctgagaaggacaag
cagcaggagaagcaccaaggctttgactttgactccttcattgccggcaccatcaagctc
agcctacagccagattcctgtgaggtgggccttctcaatgaactgaacagctctgtctca
cagctggagaccaagagccccgtcccaaagtccatcagccaagagaaggaagagaagtgc
ctggtgaacctggcccagctggaaggccggacgccccagccctgggagagctttagctgt
gcggacattactggagaagagagctgcttgattgacgaagtttgctgggatgtgaggaag
gatgagcagctgcagaaggagaccacctgcacgagctatttggacaggctgttcagtaag
aaggaggaggcgcaagagccagcggcagtggaggtggatgagggctttgtgaccagaaat
ggagagcttgtgtttaacgtgcagctggactccttggcagttccccggtttgagagccct
gctgattctcccctgaagtccatacagacgaccctgacgccctcagccataaagtgttcc
cctcaaatcgcccataaaacctatagtagcattttaaaacatctgaattaa

DBGET integrated database retrieval system