KEGG   Paramormyrops kingsleyae: 111845728
Entry
111845728         CDS       T05788                                 

Definition
(RefSeq) AP-3 complex subunit sigma-2
  KO
K12399  AP-3 complex subunit sigma
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pki00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    111845728
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pki04131]
    111845728
Membrane trafficking [BR:pki04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    111845728
 Endosome - Golgi transport
    111845728
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 111845728
NCBI-ProteinID: XP_023671118
Ensembl: ENSPKIG00000020282
LinkDB
Position
Unknown
AA seq 192 aa
MIKAILIFNNHGKPRLIRFYQYFAEDMQQQIIRETFHLVSKRDDNVCNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQVDVQNRMEKSEGGLSAAPARAVSAVKNMNLPEIPRNINIG
DINIKVPSLSPF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgattaaggctattttgatttttaacaaccatggaaaaccacgacttatcagattttat
cagtattttgctgaggacatgcagcagcaaataatcagggaaacatttcatcttgtgtcg
aagagggacgacaatgtgtgcaattttttggaagggggaagtttaattggtggctctgac
tacaagctgatctacagacattatgcaactctttactttgtattttgtgtggattcctct
gaaagtgagctgggaattttggatttaatacaggtttttgtggaaacacttgataaatgc
tttgaaaatgtttgtgaactggacctaatttttcacatggacaaggtccattatatcctg
caggaggtggtgatgggggggatggtgctggagaccaacatgaatgagatagtggcccag
gtggacgttcagaaccgcatggaaaagtcagagggtggcttgtctgctgccccagcacgg
gccgtgtctgcagtgaagaacatgaaccttccagaaatccctcgtaacatcaacatcggc
gatatcaacatcaaagttcccagcttgtccccattctga

DBGET integrated database retrieval system