KEGG   Paramormyrops kingsleyae: 111847642Help
Entry
111847642         CDS       T05788                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04020  Calcium signaling pathway
pki04114  Oocyte meiosis
pki04140  Autophagy - animal
pki04261  Adrenergic signaling in cardiomyocytes
pki04270  Vascular smooth muscle contraction
pki04310  Wnt signaling pathway
pki04340  Hedgehog signaling pathway
pki04371  Apelin signaling pathway
pki04530  Tight junction
pki04540  Gap junction
pki04910  Insulin signaling pathway
pki04912  GnRH signaling pathway
pki04914  Progesterone-mediated oocyte maturation
pki04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111847642
   04310 Wnt signaling pathway
    111847642
   04340 Hedgehog signaling pathway
    111847642
   04371 Apelin signaling pathway
    111847642
   04020 Calcium signaling pathway
    111847642
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111847642
  09143 Cell growth and death
   04114 Oocyte meiosis
    111847642
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111847642
   04540 Gap junction
    111847642
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111847642
   04912 GnRH signaling pathway
    111847642
   04914 Progesterone-mediated oocyte maturation
    111847642
   04916 Melanogenesis
    111847642
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111847642
   04270 Vascular smooth muscle contraction
    111847642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111847642
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pki03019]
    111847642
   03036 Chromosome and associated proteins [BR:pki03036]
    111847642
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111847642
Protein kinases [BR:pki01001]
 Serine/threonine kinases: AGC group
  PKA family
   111847642
Messenger RNA biogenesis [BR:pki03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111847642
Chromosome and associated proteins [BR:pki03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111847642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 111847642
NCBI-ProteinID: XP_023674786
Ensembl: ENSPKIG00000002931
LinkDB All DBs
Position
Unknown
AA seq 410 aa AA seqDB search
MLYVGWNRVLGQPPDTIDRDMAQGKEHHGRYSLPKMDNLTSRFFQRSRKSSQEHKGEGPR
VSEFALHHDRLKTFVKEFLAKAKEDFLRKWECPPQSTTGLDDFERLKTLGTGSFGRVMLV
KHRGTEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVKLEYAFKDNSNLYMVM
EYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYI
QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATT
DWIAIYERKVEAPFIPKCRGAGDTSNFDDYEEEDIRVSITEKCAKEFLEF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacgtcggatggaatcgcgtgctaggacagccaccagacacgatcgatcgcgac
atggcccagggcaaggaacatcacgggcgctacagcctgcccaagatggacaacctgacc
agccgcttcttccagaggagccgcaagagttcccaagagcacaagggggagggcccccgt
gtgtcggagttcgccctgcaccatgaccggctgaagacctttgtgaaagagttcttagcc
aaagctaaagaagacttcttacggaaatgggaatgccctccacagagcacaacgggccta
gatgactttgaaaggctaaagacactgggcaccggctcatttgggagagttatgttggta
aaacatagaggcacagagcagtactacgcgatgaagattctggacaagcagaaggtggtg
aagctgaagcagatcgagcacacgctaaacgagaagcggatattgcaggcggtgtccttt
cccttcctcgtgaagctggaatacgccttcaaggacaactccaatttatacatggtgatg
gagtacgttccgggtggagaaatgttttcgcatctcagacggatcggcaggttcagcgaa
cctcacgcacgcttctatgctgctcagatagtcctgacttttgagtacctccattcactc
gaccttatctacagagatctgaaacccgaaaaccttttaatcgatcagcatggctacatc
caggtgacagactttggttttgccaaaagagtaaaaggcagaacttggacgttgtgtgga
accccagagtacctagcaccagaaatcattctcagcaagggctacaacaaggctgtggac
tggtgggccttgggggttctgatctacgaaatggcagctggctacccgcccttctttgca
gaccagcctatccagatctacgagaaaatagtgtctggcaaggtacgattcccatctcac
ttcagctcagacttgaaagaccttttgaggaatctgctccaggttgacctgaccaagcgg
tacggaaatctgaagaacggagtgaatgacattaaaaaccacaagtggttcgccacaaca
gactggattgccatttatgagagaaaggtggaggctcctttcataccaaagtgcagaggt
gcaggcgatacaagcaacttcgacgactacgaagaggaggacatccgcgtgtctattacg
gagaaatgcgccaaggagtttctggagttttag

DBGET integrated database retrieval system