KEGG   Paramormyrops kingsleyae: 111848546
Entry
111848546         CDS       T05788                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111848546 (tgfa)
   04012 ErbB signaling pathway
    111848546 (tgfa)
SSDB
Motif
Pfam: EGF DUF1180
Other DBs
NCBI-GeneID: 111848546
NCBI-ProteinID: XP_023676409
Ensembl: ENSPKIG00000019657
LinkDB
Position
Unknown
AA seq 182 aa
MKRFLWDAIFLLTGSLFTYGQVQENSTSTPVNYPLAAAVHSHFGDCPDSHSQFCFHGTCR
FLVQEDTPACVCHAGFVGMRCEHADLLAVVATNQKQQTVATLLVLCVIGSAMLILFFSLV
HCCRRRGLCSPGRAVLRCHTEKHSAFLTDSASCCPSETASSSGSPTLSLKCHFKASRNFY
GC
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaagcgatttctctgggatgcgatcttccttcttaccgggtctctctttacttatgga
caggtccaggaaaattccacatcaacaccagtaaactacccgctggcagctgctgttcac
tctcactttggggactgtccagattctcacagccagttctgcttccacgggacctgccgg
ttcctggtgcaggaggacaccccagcctgtgtgtgtcatgctggctttgtggggatgcgc
tgtgagcacgcagacctgctagcggttgtggcaaccaatcagaagcagcagacggtggcc
acgctgctggtgctgtgtgtgattggctctgcaatgctgatactcttctttagcctggtg
cactgctgtcgaaggcggggactctgcagcccgggtcgcgctgtcctgcgatgccatact
gagaaacacagcgcattcctgacggacagtgcctcctgctgtccttctgaaacagcgtcc
tcctctggctccccgaccctctcgctgaaatgccacttcaaggcttcaaggaatttctat
ggatgctaa

DBGET integrated database retrieval system