KEGG   Paramormyrops kingsleyae: 111848592Help
Entry
111848592         CDS       T05788                                 

Gene name
card9
Definition
(RefSeq) caspase recruitment domain-containing protein 9
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04621  NOD-like receptor signaling pathway
pki04625  C-type lectin receptor signaling pathway
pki05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pki00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111848592 (card9)
   04625 C-type lectin receptor signaling pathway
    111848592 (card9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111848592 (card9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD KASH_CCD
Motif
Other DBs
NCBI-GeneID: 111848592
NCBI-ProteinID: XP_023676514
Ensembl: ENSPKIG00000019487
LinkDB All DBs
Position
Unknown
AA seq 562 aa AA seqDB search
MSITEDEECWVQLEDYRMLLIKSIEPSRITPYLRQCKVLSSEDEEQIFNDPSLVIRRRKV
GVLLDILQRTGHKGYVAFLESLELDYPQLYRKITGKEPARVFSILVDTAGESGLTQFLMT
EMTRLQKALQEERLRRQEVSARMAAQQDTIRRQQVRESELRKQQERVCRMRKERDKLVEE
ARQLKDENYSLLRDVTRLTEEKSKALMDARDLQMEIERLKHSLMNAESDSKIQRKRTVTL
KHAMEMRPSQDAVWHMQRENDLLKAQVEELENCIQTASGSAQAEEAKLKNQCMEFCKQRQ
AQHQELVNSLYGLRRELRSAEELRDKYMNEKEVWELQCTLLEKDCKVYRERMEDIVKQME
EVTAERDKAIRTREEYHMENCQNIQAKDQYRKQIQELGERCDELQVQLFRTQGKVISLEG
KLRQTSCPASPQLASDIEDGPLQSWLEKSQTSEDDIKDRSRPASSEEPRSLNSDDICEFQ
PLQDSTKSQGSLLSEIPVTSQDIQSNDSPSRRPRMYCHFNYRRQLAVRSKTTCKKDQEFD
QDNTSGSDNTDTEGMSPCEGGT
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcacggaggacgaggagtgctgggtgcagctggaggactacaggatgctgctc
attaagagcatcgagccatctcgcatcacaccctacctgcgccagtgcaaggtcctcagc
agcgaggacgaggagcagatcttcaacgaccccagtctggtcatccggcgccggaaagtg
ggcgtgctgctggacatcctgcagaggaccggacacaagggttatgtggcgttcctggaa
agcctggagctggattatcctcagctgtaccgcaagatcacagggaaggaaccagctcgt
gtcttttccatactagtagacacggcaggggagtcggggctgacccagttcctgatgacc
gaaatgactcgcctacagaaggccctgcaggaggagcgtctgcgcagacaggaggtgtct
gcacgcatggctgcgcagcaggacacgatccggcggcagcaggtgcgggagagcgagctg
cggaaacagcaggagcgcgtgtgccgcatgcggaaggagagggacaagctggtggaggag
gccaggcagctgaaggacgagaactacagcctgctccgtgatgtcaccaggctgacggag
gagaagagcaaagcgctcatggacgcccgcgacttgcagatggagatcgagaggctgaaa
cacagtctgatgaacgcagagagcgactcgaagattcagcgtaagcggactgtgaccctg
aagcacgctatggagatgcggcccagccaggacgcagtgtggcacatgcagagggagaat
gaccttcttaaagcccaagttgaggaactagagaattgtatccagacagcatcaggttca
gcacaagcagaagaggccaagctgaaaaaccagtgtatggagttctgtaagcagaggcaa
gcacagcaccaggagctggtcaacagtctctacggcttgcggagggaactgcgcagcgca
gaggagctccgggacaagtacatgaatgagaaggaggtgtgggagttgcagtgcacccta
ctagagaaagactgcaaggtgtatcgcgagcggatggaagacattgtgaaacagatggag
gaggtgacagcagagagggacaaggcgattcgtaccagagaggagtatcacatggagaac
tgccagaacatccaggctaaggaccagtatcggaagcagatccaggagctgggcgagcgc
tgtgatgaactgcaagtccagctgttccgaacgcaaggcaaggtcatctcactggagggg
aagctacgccagacaagttgtcctgcatctccacaactggcttcagacattgaagatgga
cccttacaaagctggctagagaagagccagacgagcgaggacgacatcaaggacaggtct
cgcccagcttcgagtgaggaacctcggagtctgaactcagatgacatctgtgaatttcag
ccgctgcaggacagtaccaaatcccaagggtctcttctcagcgaaattccagtcacttcc
caggatatccaatccaatgatagtcccagcaggagacccagaatgtattgtcatttcaac
tacaggagacagcttgcagtgaggtcaaagaccacttgcaagaaggatcaagagttcgac
caggacaacacatcagggagtgacaatactgacacggagggcatgtcaccctgtgaggga
gggacatag

DBGET integrated database retrieval system