KEGG   Paramormyrops kingsleyae: 111848593Help
Entry
111848593         CDS       T05788                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04141  Protein processing in endoplasmic reticulum
pki04210  Apoptosis
pki04217  Necroptosis
pki04621  NOD-like receptor signaling pathway
pki04622  RIG-I-like receptor signaling pathway
pki04920  Adipocytokine signaling pathway
pki05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pki00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111848593
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111848593
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111848593
   04217 Necroptosis
    111848593
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111848593
   04622 RIG-I-like receptor signaling pathway
    111848593
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111848593
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111848593
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pki03019]
    111848593
   04121 Ubiquitin system [BR:pki04121]
    111848593
Enzymes [BR:pki01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111848593
Messenger RNA biogenesis [BR:pki03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111848593
Ubiquitin system [BR:pki04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111848593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 FPP Tropomyosin_1 zf-RING_6
Motif
Other DBs
NCBI-GeneID: 111848593
NCBI-ProteinID: XP_023676515
Ensembl: ENSPKIG00000019732
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MASSSLSCSLDSSMQGIPQSVLMVSMETKYQCQHCEGVLRMPSQARCGHRFCGNCFSELT
SLGPLPCKACQRDGIFEDPLSIINASDAFPDNAARREIENLPAQCPSEGCPWRGVVKDYE
AQHEGRCEHEQVQCEACQAFVPRLHMARHADRECEARSVTCKFCKATFSSKDIKGHNNVC
QKFPLHCEACGKRKIPREMFADHLNSCGKQQKACQFSTLGCETLLENETQGNHEQANVLE
HMRLLLAKVVVLQKQHAPGPAECEEGVALGLYRAPVDGEAGRNNNLEPKVAALENIVYVL
NREVERCAFTLEAFTCQQRLDQQQIETLKNKLQQLERLLAMRDLQLAEAEQVLHELAVCT
YDGIFVWKIAEFSRRREEAVSGFAPTMFSPAFYSSKYGYKMCMRLYLNGDGTGRGTHLSL
FFVVMRGKYDGLLKWPFSQKVTLMLLDQSNREHVVDAFRPDVSSTSFQRPISEMNIASGC
PLFCPIAKLGGKSVYLKDDTIFIKAIVDLTSLQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctcctcgctctcctgctccctggattcctctatgcagggaatcccccagtca
gtgttgatggtctccatggagaccaagtaccagtgccagcactgcgagggggtgttgagg
atgccctcccaggcgaggtgtgggcaccgtttctgcggaaactgcttcagtgagctcacc
agcttgggccccctgccttgcaaggcatgccagcgagacgggatctttgaagacccgctg
tccatcataaacgccagtgatgcttttccagacaacgctgcgcggagggagattgaaaac
ctgccagctcagtgtcccagtgaaggctgtccatggagaggggttgttaaggactatgag
gcacagcatgagggccgctgtgaacatgagcaggtgcagtgtgaggcctgccaggccttc
gtcccacggctccacatggccaggcatgccgacagggagtgtgaggcgaggagtgtgacc
tgcaagttctgcaaggccaccttcagctccaaggacatcaaggggcacaacaacgtttgt
cagaagttccctcttcactgtgaggcctgtggcaagaggaagatcccccgggaaatgttt
gccgatcatttgaattcttgcgggaagcagcagaaggcctgtcaattcagcaccctgggc
tgtgaaaccttgctggagaacgagacgcaaggcaaccacgagcaggccaacgtcttggag
cacatgcgcctccttctggctaaggtggtcgtgcttcagaagcagcacgccccgggcccg
gcagagtgtgaagaaggcgtggcactgggcctgtatagagcacctgtggatggggaagcg
ggacggaacaacaacctggagcctaaggttgctgctctggagaacattgtgtatgtactg
aacagggaggtggagaggtgtgctttcaccttggaggctttcacctgtcaacaacggctg
gaccagcagcagatcgagacccttaagaacaagctgcagcagctggagcgcttgctggcc
atgcgggacctgcagctggccgaggcggagcaggtgctgcacgagctcgccgtctgcacc
tacgacggcatctttgtctggaagatcgcagagttctcccgccgcagggaggaggcggtg
agcggtttcgcccccaccatgttctctccagcattttactccagtaaatacggctacaaa
atgtgtatgcggctgtacctgaacggcgacgggacgggccgggggacgcatctctcactc
ttctttgtggtgatgaggggaaaatatgacggcctgctcaagtggccctttagccagaag
gtaacgctgatgctgttggatcagagcaaccgggagcatgttgtcgatgccttcaggcct
gacgtcagctccacgtcgttccagaggcccatcagtgagatgaacatcgccagtggatgt
ccacttttctgcccaatagcaaagcttggtgggaagagcgtttatctcaaggatgatact
atattcatcaaggccattgtggacctcaccagcctccaatga

DBGET integrated database retrieval system