KEGG   Paramormyrops kingsleyae: 111848769
Entry
111848769         CDS       T05788                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pki  Paramormyrops kingsleyae
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 111848769
NCBI-ProteinID: XP_023676779
Ensembl: ENSPKIG00000001347
LinkDB
Position
Unknown
AA seq 271 aa
MRDGGGEEQTSSFEMTWGSTTSSGYCSQEDSDCEFEQYFTARTSFIRKPRKERDEQVEWG
KQELSVSEIEQKVKEYNAQINSNLFMALNKDGSYTGFIKVHFKLIRPVSVPPPRKMAASQ
DGGRRGTCVKRRTSFYLPKDTAKHLHISSRTRAREVIEALLNKFTVVDNPRKFALFERSE
RHDQVYLRKLADDERPLQLRLCAGPSEKVLSLVLKENETGEVNWDAFSMPELHNFLRILK
REEEEHVKQIVQRYAHARDKMLEALTSSTPG
NT seq 816 nt   +upstreamnt  +downstreamnt
atgagagacggcggcggcgaggaacagacctcttccttcgagatgacgtggggcagcacg
accagcagcggctactgcagccaggaggactcggactgcgagttcgagcagtacttcacg
gcgcggacctccttcatccgcaaacccaggaaggagagggatgaacaggttgagtgggga
aagcaggagctgtctgtcagcgagattgagcagaaggtgaaggagtataacgctcagatc
aacagtaacctcttcatggcactgaacaaagatggctcctacactggcttcatcaaggtc
cacttcaaactgatacgacccgtgtcggttcccccgccccgaaagatggctgcatcacag
gatgggggtcgtcggggcacgtgtgtgaagcggcgcacctcattctaccttcccaaggac
acggccaagcacttgcatattagctcacgcacccgtgcccgagaggtgatcgaagcactg
ctgaacaagtttaccgtggtggacaacccccgcaagtttgccttatttgaacgcagtgag
cgtcatgaccaggtgtacttgcggaagctggcagatgacgagcgcccccttcagctgcgg
ctgtgtgcgggacccagtgaaaaggtcctcagcttggtgctgaaggaaaatgagacaggg
gaggtcaactgggatgccttctccatgccggagttgcacaatttcttgcgtatcttaaag
cgtgaggaggaagagcatgtcaagcagatcgtgcagcgctatgcccatgcacgagacaag
atgctagaggcgctgaccagcagcactccaggctga

DBGET integrated database retrieval system