KEGG   Paramormyrops kingsleyae: 111849029Help
Entry
111849029         CDS       T05788                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00010  Glycolysis / Gluconeogenesis
pki00051  Fructose and mannose metabolism
pki00052  Galactose metabolism
pki00500  Starch and sucrose metabolism
pki00520  Amino sugar and nucleotide sugar metabolism
pki00524  Neomycin, kanamycin and gentamicin biosynthesis
pki01100  Metabolic pathways
pki01200  Carbon metabolism
pki04910  Insulin signaling pathway
Module
pki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pki_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111849029
   00051 Fructose and mannose metabolism
    111849029
   00052 Galactose metabolism
    111849029
   00500 Starch and sucrose metabolism
    111849029
   00520 Amino sugar and nucleotide sugar metabolism
    111849029
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111849029
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111849029
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pki04131]
    111849029
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111849029
Membrane trafficking [BR:pki04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111849029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111849029
NCBI-ProteinID: XP_023677295
Ensembl: ENSPKIG00000008533
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQIKKIDKYLYAMRFSDETLLDVMGRFRRELEFGLKRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYDTPEDIIH
GSGTRLFDYVAECLGDFMDKQKIKDKKLPVGLTFSFPCAQSKLDEGILLTWTKRFKASGV
EGMDVVKLLNKAIKKQGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGMLFEGRITPELLTKGKFETKHVSAIEKSKEGLSKAKEILTRLG
VEPSHDDCVAVQHVCAVVSFRSANLIAATLGAILHRLKDNKGTPRLRTTVGIDGSLYKMH
PHYARRLHKTVRRLVPDSDVRFLLSESGSAKGAAMVTAVAYRLADQSRQIAQTLAEFRLT
KEQLLVVKRKMRIEIENGLGKQSHNTSTVKMLPTFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEIMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGF
TFSFPCKQTSLDAGILIKWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIETVEGTEGRMCVNMEWGAFGDNGCLDD
IRTKYDEAVDELSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQQLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSKVMHQTVKELAPQCDVNFLLSEDGSGKG
AALITAVGCRMRQQEQQN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgctcagctcctggcctactacttcacggaacttaaggatgaccagatcaag
aagattgataagtacctctatgccatgcgcttttcggatgagacgctactggatgtaatg
ggccgcttcaggcgggagctggagtttggccttaagcgcgacaccaaccccacggctaca
gtcaagatgctgcccaccttcgtccgctccatacctgatggctcagaaaagggagatttc
attgctcttgacctgggagggtccaacttccgaatcttgcgggtgaaggtgtcccatgag
aagaagcagacggtgcagatggagagtcagatatacgacaccccagaagatatcatccat
gggagtggaacccggctttttgactatgtggcagagtgcctcggtgacttcatggacaag
cagaaaataaaagacaagaagcttccagtcggactgaccttctccttcccgtgtgcccaa
agcaaactggatgagggcattttgctaacctggacaaaacgtttcaaagctagtggggtg
gaggggatggatgtggtgaagctcctcaacaaggccatcaagaagcaaggggactatgat
gcagatatcatggcagtggtcaacgacacggttggaactatgatgacctgtggatttgac
gaccagcgctgtgaagttggcattatcatagggacaggcaccaatgcctgctacatggag
gagatgaggcacatcgacctggtagagggagacgagggccgcatgtgtatcaacaccgag
tggggagctttcggcgacgatggcatgctagaggacattcgcactgagtttgaccgggag
atcgaccggggctccctcaacccagggaaacagctgtttgagaagatggttagcgggttg
tacatgggtgaacttgtccgcctcatcctggtcaagatggccaaggaggggatgctgttt
gagggaaggatcacccccgagcttctcaccaaagggaaatttgaaacaaaacatgtctct
gctatcgagaagagcaaggagggcctgtccaaggccaaggagatcctgacccggctggga
gtggagccgtcgcatgatgactgtgtggctgtgcagcatgtgtgtgctgtggtttcattc
cgctctgcgaacctcattgcggccacactgggtgctatcctccaccggctgaaggacaac
aagggtactccacggctgcgcaccaccgtgggcatcgatggctccctctacaagatgcac
ccacactatgcccgacgtctgcacaagactgtacggcgcctggtcccagattcggacgtg
cgcttcctgctgtcagagagtgggagtgccaagggtgctgccatggtgactgcggtggcc
tatcggctggcggatcaatctcggcagattgcccagacactggctgagtttcggctgaca
aaggagcagctgctggtggtcaagaggaagatgaggatagagatagagaatgggctcggc
aaacaatcccacaacacctccactgtcaagatgctgcccactttcgtccgcagtacgcct
gatgggacagaacacggggacttcctggcactggacctgggggggacaaacttcagggtt
ctgctggtgaagattcgcagtggaaagaggcggactgtggagatgcataacaaaatctat
gctatcccactagagatcatgcagggcactggggaagagctctttgatcacatagtgcac
tgcatctctgacttcctggactacatgggaatgaagaatgcccgtttacctttgggattc
accttctcctttccctgtaaacagaccagcctggatgcgggtatcctaataaaatggact
aaaggtttcaaggccactgactgtgagggtgaggatgttgtgaacctgctccgggagggg
atcaagaggagggaggagtttgacctggacgtggtggctgtggtgaacgacacggtaggg
acaatgatgacatgtgcttacgaagagcccacttgtgagattggactcatcgcaggcact
gggagcaacgcgtgttatatggaggagatgcgcaacatcgagacagttgagggcaccgaa
ggccgcatgtgcgtcaatatggaatggggcgcctttggggacaatgggtgcctggatgac
atcaggacgaagtatgacgaggcagttgatgagctctcactcaatgccggaaaacagaag
tatgagaaaatgtgcagtgggatgtaccttggtgagatcgtcaggaacatccttattgac
cttacaaagcgagggtttctgttcagggggcagatttcagagaccctgaaaactcggggc
atctttgaaaccaagtttctttcccagattgagagtgatcggctggcactgctgcaggtc
agatcaattctgcagcagttgggcctggacagcacgtgtgatgacagtatcattgtcaag
gaagtgtgtggcaccgtgtcccgccgagccgcccagctatgtggagctggcatggctgcc
gtcgttgacaagatccgtgagaaccgaggactggaccacttggatatcactgtgggggtg
gatggcacgctctacaagctccatccacacttctcaaaggtcatgcaccaaacggtgaag
gagcttgcaccccagtgtgatgtcaacttccttttgtcagaggatggcagcggcaaggga
gcagcgctgatcacagctgttggctgccgcatgcgacagcaagagcagcagaactga

DBGET integrated database retrieval system