KEGG   Paramormyrops kingsleyae: 111849223
Entry
111849223         CDS       T05788                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04080  Neuroactive ligand-receptor interaction
pki04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111849223
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111849223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pki04030]
    111849223
G protein-coupled receptors [BR:pki04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111849223
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 111849223
NCBI-ProteinID: XP_023677690
Ensembl: ENSPKIG00000014536
LinkDB
Position
Unknown
AA seq 372 aa
MCIEIVGDDAPGCYCNRTLEFFYNHSGKYINDSWTSQSLLVVILGIIVCAFILFANSLVM
VAIIINRGFHYPIYYLLGNLAAADLFAGASYLYLMFHTGPWTKKLSKPQWFLRQGLIDTS
LTASVVNLLAVAVERHQTIFTMQLHSKMSNRRVTLLILGIWLVALLMGLIPSMGWHCLCD
VENCSIMAPLYSRSYLVFWAVLNLVTFTIMVVVYLRIFLYVRRKSQRMSQHTTQTKHKET
VVSLMKTVTMILGAFVICWTPGLVILLVDGLEAGKSVLIVEKYFLVLAECNSLINPIIYS
LRDKEMLSTFKRILCCLCRRGGVQGSASSVRFDTLRQETLKSNTIKMKKTMGKTAQCPNN
IPATSNDGQTAK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtgcatagagattgtaggcgacgacgcacccgggtgctactgcaaccggacgctggag
ttcttctacaaccacagtgggaagtacatcaacgattcatggacctcgcaaagcctgctg
gtggtgatcctgggcatcatagtttgtgccttcatcctctttgccaacagcttggtcatg
gtggccatcatcatcaaccgtggcttccactaccccatctactacctactgggcaacctg
gctgcggccgatctgttcgccggtgcctcttacctctacctgatgttccatacgggcccc
tggaccaaaaagctgtctaagccccagtggtttcttcggcagggtctgatcgacacaagc
cttacggcctctgtggtgaacctgctggccgtggcagtggaaagacaccagaccatcttc
accatgcagctccacagcaagatgtccaaccggcgggtgacgctgctcatcctgggcatc
tggctagtggccctactgatgggcctcatccccagcatgggctggcactgcctatgtgac
gtggagaactgttccattatggcgcctttgtacagcagaagctacctggtcttctgggcc
gtgctcaacctggtcacctttaccatcatggtggttgtgtacttgcgcatcttcctgtac
gtgcgcaggaagagccagaggatgtcgcagcacaccacacagactaagcacaaggaaacc
gtcgtgagtctcatgaagaccgtgaccatgatcctgggtgcttttgtgatctgctggacc
cccggtctggtaatccttctggtggacggcctcgaggcggggaaaagtgtcctgatagtg
gagaagtacttcctggtcctcgccgagtgtaactctctgatcaaccccatcatctactct
ctgcgggacaaggagatgctgtcgacgtttaaacgcatcctgtgctgcctctgcaggagg
ggtggggtgcagggcagcgcttccagcgtgcgctttgacaccctgcggcaagagacatta
aagagcaacaccatcaaaatgaagaagactatggggaagaccgcccagtgccctaacaac
atccctgcaacgtcgaacgatggccagactgcaaaatga

DBGET integrated database retrieval system