KEGG   Paramormyrops kingsleyae: 111849224
Entry
111849224         CDS       T05788                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04080  Neuroactive ligand-receptor interaction
pki04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111849224
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111849224
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pki04030]
    111849224
G protein-coupled receptors [BR:pki04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111849224
SSDB
Motif
Pfam: 7tm_1 DUF4752 WBP-1
Other DBs
NCBI-GeneID: 111849224
NCBI-ProteinID: XP_023677692
Ensembl: ENSPKIG00000014611
LinkDB
Position
Unknown
AA seq 371 aa
MCIDIDGDDTPGCYCNRSLEFFYNHSDKHISNSWTSQNLLVVILGIIVCAFILFANSLVM
VAIIINRGFHYPIYYLLGNLAASDLFAGASYLYLMFHTGPWITKMTKAQWFVRQGLINIS
LTASVVNLLAVAVERHQIIFTVKFHSRISNCRVALLILGIWLVALLMGLIPSMGWHCLCD
LKNCSTMVPLYSRSFLIFWAVLNLVIFIIMAIMYLRIFLYVHKKIQRISQHQTQKKQMDT
VMSLVKTLTMILGAFVICWTPGLVVLLLDGLGYRGTGILKVHEYFMVLAECNSVVNPIIC
SLRNQEMLSTFKGILCSPCRRGGVQSVPADTLIQEQLQNEEDLGKTPQRRVNAPAVQNHG
PIVEQTLTLES
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgtgtatagacattgacggcgacgacacacccggatgctactgcaaccggtcgctggag
ttcttctacaatcacagtgacaagcacatcagcaattcgtggacctcgcaaaacctgctg
gtggtgatcctgggcatcatagtttgtgccttcatcctctttgccaacagcttggtcatg
gtggccatcatcatcaaccgtggcttccactaccccatctactacctactgggcaacctg
gctgcgtccgacctgtttgccggcgcctcttacctctacctgatgttccatacgggcccc
tggattacaaagatgaccaaagcccagtggtttgtgcggcagggtctgatcaacataagc
ctgacagcgtctgtggtcaatctgctggccgtggccgtggaaaggcaccagattatcttc
actgtcaagttccacagcaggatatccaattgtcgggtggcactgctcatcctgggcatc
tggctagtggccctgctgatgggcctcatccccagcatgggctggcactgcctgtgtgac
ctgaaaaactgctccaccatggtgcccttatacagcaggagcttcctgatcttctgggcc
gtgctcaacctggtcatctttattatcatggcgatcatgtacttgcgcatcttcctgtac
gtgcacaagaaaatccagaggatatcccagcaccaaacacagaaaaagcaaatggatact
gtcatgagtctcgtgaagaccttgaccatgatcctaggtgcttttgtgatctgctggact
ccaggtctagtggtcctcctgctagatggccttggctacaggggcacaggcatcctgaag
gtgcatgagtacttcatggtcctggctgagtgtaactctgtggtcaaccccatcatctgc
tccttgcggaaccaagagatgctgtcgacctttaagggcatcttatgtagcccctgcagg
aggggcggggtgcagagcgttcctgctgataccctgattcaagagcaactccaaaatgaa
gaggacttagggaagaccccccagcgccgtgtcaacgcccctgcagtgcagaatcatggc
ccgattgtcgaacaaacactcactttggagtcttaa

DBGET integrated database retrieval system