KEGG   Paramormyrops kingsleyae: 111850064
Entry
111850064         CDS       T05788                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04020  Calcium signaling pathway
pki04144  Endocytosis
pki04510  Focal adhesion
pki04540  Gap junction
pki04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111850064
   04020 Calcium signaling pathway
    111850064
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111850064
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111850064
   04540 Gap junction
    111850064
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111850064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111850064
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pki04090]
    111850064
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111850064
Protein kinases [BR:pki01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111850064
CD molecules [BR:pki04090]
 Proteins
  111850064
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2
Other DBs
NCBI-GeneID: 111850064
NCBI-ProteinID: XP_023679298
LinkDB
Position
Unknown
AA seq 986 aa
MGVAWAILSFGVCFIGILLGPRAIKSESSPPLIHPDLPELVVKRHASINLTCSGTRAVSW
VPPLSDNAVVKREDHRTAVLMIKDASAANTEALVCEYDDWQGAEEDKQAEIYIFVPDPEI
PFAPENVSGETDLLTDIPCRVTNPDWHVVLRSVHSRTEVPAPYFNKIGFLGTFPEGSYVC
ETTVNGKTRSSAIYTVKADRGKDDDFQLKLHASQPAVRVGEPFSLTCEGPAGDSYQQTWL
HPSKQITGAEESRQAVAGTMHYALSIRAASEQDTGFYDCAVTDTLTGMTRVQRVSVTVLP
GTTFIRLDHNIAPLEFSTSLEESVFSVFIDAYPAPKVQWLKDNVAIDESQHNIFIKFNAI
TANRYLSRLTLSRAQEGDGGNYTIVVSHEKVPLDGKAVHYSFQLRVRGADPQPLLLALPE
IWPQQTEMVVPLHQEFTLKCKGEREVLWDLPIFPGDFLEDTEEDNSGLFVTTLTVINATV
EYTGSYSCHHVDSNHTEQDLTGIYVYVPDPDMPFVPSLDPYSKHVLASMDDMEIQCRVSD
PRTNVTLLNVDTQKEVPATYDSKRGMVGLFSSGTYVCKALVNGEEHYSEEYIIHGWTTND
DLQVELRVEHTALLVGQKLVVSCIARGSEMLEDLWKYPGKMGSRGVKTVRESKASQEINY
TLTISQATTKDSGLYECSITDIMTTITRTKKVEITVYERDFISLEPTFTAVQSADLDEVK
EFMVIIDSFPTARVTWLKDGKVLNDVNAEMTSNLRRVNETRYQGTLVLIRAKEEDSGNYT
IQVRNGNLTQSFSFTLKVKVPPKIVQLMDLHHSSATGQSVVCIAGGQPVPEVEWFVCKNI
KLCSNDSSQWTSLVVNSTDITLETHVNQDNQLESQVIFAKLENSLALRCLARNELAVASR
EVKLVSNALQSELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEY
IYVDPMQLPYDSRWEFPRDGLVLGEP
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgggtgtcgcgtgggccatcctttcatttggagtctgtttcatcgggatcctcttaggt
ccccgggccattaagagcgagtcttcacctccactcatccatcccgacctgcccgagctt
gttgttaaacgtcacgccagcatcaatttgacctgttccgggacgagggccgtcagctgg
gtgcccccgctgtcggacaatgccgtggttaaacgggaagaccaccgaaccgccgtgctg
atgattaaagacgcgtccgccgccaacactgaagccctagtgtgcgagtacgacgattgg
cagggtgcagaggaagataagcaggctgaaatatacatatttgtacctgacccagagatt
ccattcgctcccgaaaatgtctcaggggaaacggaccttttgaccgacatcccttgtcgc
gttacaaacccggactggcacgtcgtgctcagaagtgtccattcccggacggaggtgccc
gcaccatatttcaacaagatcggcttcctggggactttccccgaaggctcctacgtgtgt
gaaaccaccgtgaacggcaagactcggagcagcgccatctacacggtcaaggccgatcga
ggaaaagacgatgatttccagttgaagctgcacgccagtcagccagccgtgcgggtgggc
gagcccttcagcctcacctgtgaaggccccgctggggactcgtaccagcagacgtggctg
caccccagcaagcagatcactggtgctgaagagagcaggcaggctgttgctgggaccatg
cactacgccctaagcatccgtgcagcatctgagcaggacaccgggttttatgactgcgcc
gtcaccgatactctgaccggcatgaccagagtccagagggtgtctgtcacggtcttaccg
ggtaccacgttcatcagactggaccacaacatcgcgccgctggaattttcgaccagtctg
gaagagagtgtgttcagcgtcttcattgatgcgtaccctgcccccaaagtccaatggctg
aaggacaatgtggccattgatgagagccaacataatatcttcatcaaatttaacgcaatc
actgctaacaggtacctgagcagactgacgctctcccgcgcccaggagggcgacggtggg
aactacacgattgtggtctcccatgagaaggtgccgctcgatggcaaggcggtgcattac
tccttccagctgagagtgagaggcgccgatccgcagcccctgctgctggcactgcccgag
atctggccccagcagacggagatggtcgtccctctccaccaggaattcaccctcaagtgc
aagggtgagcgggaggtgctctgggacttgcccatcttcccaggagacttcctggaggac
acagaggaggataacagtggcctttttgtgaccacgctcactgtgattaatgcaactgtg
gagtacaccggctcttactcctgccatcatgtggacagcaaccacaccgagcaagacttg
actggcatctacgtctatgttccagaccccgacatgcccttcgtcccatctctggacccc
tacagcaagcacgtcctggccagtatggatgacatggaaatccagtgccgagtgtcagac
cccaggaccaatgtgacgctgctgaatgtggacacacagaaggaggtgccggccacctat
gacagcaagcggggcatggtgggcttattcagctccggcacctacgtctgcaaggccctg
gtcaacggcgaggagcactacagtgaggagtacatcatccatggatggacaactaacgat
gacctccaggtggagcttcgtgtggaacacacagctctgctggtggggcagaagctggtg
gtgagctgtatagcacgtggcagcgagatgctggaggacctctggaagtaccctgggaag
atgggctcaaggggagtgaagacagtgagggagagcaaggcatcccaggagatcaattat
acgctgaccatctcccaggccaccaccaaggacagtggcctctacgagtgctccatcact
gacatcatgaccacaattactcggaccaagaaggtggaaatcacagtctatgaaagggat
ttcatatctctggagcccaccttcactgccgtgcagtctgccgatctagacgaggtgaag
gaatttatggttatcattgatagcttccccactgccagggtcacctggctgaaggacggc
aaggtgctgaacgacgtcaacgctgagatgaccagcaaccttcggcgcgtcaacgaaacc
aggtaccaaggtaccttggttctgatccgagcaaaggaagaggacagtggaaactacacc
atccaagttagaaatgggaacctgacccagagcttcagtttcacgttgaaggtgaaagtg
ccaccaaaaattgtgcagctgatggacctgcaccacagctctgccacaggacagtctgtg
gtgtgcattgcaggagggcagcctgtgccagaagtggagtggtttgtctgcaagaacatc
aaactatgctctaatgattcatctcagtggacctccctggttgtcaactccaccgatatc
accttggagactcacgtaaaccaggacaaccagctggagagtcaggtgatctttgccaaa
ctggagaactctctggctcttaggtgcctggcaaggaacgagctagcggtggctagccgg
gaagtgaaactcgtctcaaatgccctacagtctgagctcacggttgcagctgctgtcctg
gttctgttggtcattgtcatcatctctctcattgtcctggtcattatctggaagcagaaa
ccccggtatgagattaggtggcgtgtcattgaatcaattagtccagatggacacgaatac
atctatgtggatcccatgcagcttccatatgactccagatgggagtttccccgtgatgga
cttgttttgggtgagccttga

DBGET integrated database retrieval system