KEGG   Paramormyrops kingsleyae: 111850581Help
Entry
111850581         CDS       T05788                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00010  Glycolysis / Gluconeogenesis
pki00053  Ascorbate and aldarate metabolism
pki00071  Fatty acid degradation
pki00280  Valine, leucine and isoleucine degradation
pki00310  Lysine degradation
pki00330  Arginine and proline metabolism
pki00340  Histidine metabolism
pki00380  Tryptophan metabolism
pki00410  beta-Alanine metabolism
pki00561  Glycerolipid metabolism
pki00620  Pyruvate metabolism
pki01100  Metabolic pathways
Module
pki_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111850581 (aldh2)
   00053 Ascorbate and aldarate metabolism
    111850581 (aldh2)
   00620 Pyruvate metabolism
    111850581 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111850581 (aldh2)
   00561 Glycerolipid metabolism
    111850581 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111850581 (aldh2)
   00310 Lysine degradation
    111850581 (aldh2)
   00330 Arginine and proline metabolism
    111850581 (aldh2)
   00340 Histidine metabolism
    111850581 (aldh2)
   00380 Tryptophan metabolism
    111850581 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111850581 (aldh2)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111850581 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111850581
NCBI-ProteinID: XP_023680376
Ensembl: ENSPKIG00000023260
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRCTLSRISPAIARMPACFYSAAAIPAPSTQPPVHFNKLFINNEWHDSVSKKTFPTINP
TTGEVICQVAEGDKGDVDKAVKAAKDAFRLGSPWRRMDASDRGLLLNRLADRIEQDAAYL
AELETLDNGKPYAVAYSVDLPHVVKCFRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVAHLIKEVGFPAGVVNIIS
GMGPTAGAAITSHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIIMSDAN
MDEAVEQAHFALFFNQGQCCCAGSRTFVQESIYKEFVERSVERAKRRVVGDPFNLSTEQG
PQVDEEQFQKILGYISSGKREGAKLMCGGGVAADRGYFIQPTIFGDVQDDMTIAREEIFG
PVMQILKFKTIEEVVERANDTKYGLAAAVFTKDIEKAHYISGSLRAGTVWINCYDVFGVQ
APFGGYKASGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctgcaccttatcgcggatctccccggccatcgcgcgcatgccggcctgcttc
tactcggcggcggcgattccagcccccagcacccagcctccagtgcatttcaacaagctc
ttcatcaacaacgagtggcatgattctgtgagcaagaagaccttccccaccataaaccca
actaccggcgaagtcatctgccaggtggcagagggggacaagggggatgtcgataaggca
gtcaaagcagccaaggatgcctttcggctcgggtctccgtggcgccggatggatgcctca
gatcgagggctgctcctaaaccgcctggccgacagaatcgagcaggacgccgcttacctg
gccgagctggagactctggacaacggcaagccgtatgcagtggcttactccgtagacctg
cctcatgtagtgaagtgcttcaggtattatgctggctgggcagacaagtgggaggggaag
accatccccatcgacggggactacttctgctacacccgacacgagcccattggtgtctgt
ggccagatcatcccatggaacttccctctgctgatgcaggcctggaagctgggcccagct
ttagccacggggaacacggtggtcatgaaggtggcagagcagactcccctcaccgctctc
tatgtggctcacctcatcaaggaggtcggcttcccagctggagtggtgaacatcatctct
gggatgggtcccactgccggggcggccatcacctctcacatggacgtcgacaaggtggcc
ttcacaggctccacagaggtgggccacctcatccagcaggcctccggcagcagcaacctg
aagaaggtgaccctggagctgggggggaagagtcccaacatcatcatgtctgatgccaac
atggacgaggcggtggagcaggcccactttgctctgttcttcaaccagggccagtgttgc
tgtgctggttctcgcaccttcgtccaggagagcatctacaaagagtttgtggagcgcagc
gtggagagagccaagcgcagggtggtgggagaccccttcaacctcagcacagagcaaggg
cctcaggtggatgaggagcagttccagaaaattctgggctacatcagctcggggaagcgt
gagggggccaagcttatgtgcggaggaggagtggcagctgaccgtgggtacttcatccag
cccaccatctttggggacgtccaggacgacatgaccatcgctcgggaggagatctttgga
ccggtgatgcagattctgaaattcaagaccatagaagaagttgtggagagagccaacgac
accaaatatggactggcggctgctgtcttcaccaaagacatagagaaagcccattacatc
tctgggagtctccgtgcaggcactgtatggataaactgctatgacgtatttggggtccag
gctccttttggaggttacaaagcctctgggaatggccgagaactgggagaatatggtctg
gacaactacactgaagtgaaaacggttaccatcaaggtgccacagaagaattcctag

DBGET integrated database retrieval system