KEGG   Paramormyrops kingsleyae: 111851863
Entry
111851863         CDS       T05788                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04068  FoxO signaling pathway
pki04110  Cell cycle
pki04115  p53 signaling pathway
pki04218  Cellular senescence
pki04310  Wnt signaling pathway
pki04340  Hedgehog signaling pathway
pki04371  Apelin signaling pathway
pki04510  Focal adhesion
pki04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111851863
   04340 Hedgehog signaling pathway
    111851863
   04371 Apelin signaling pathway
    111851863
   04068 FoxO signaling pathway
    111851863
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111851863
   04115 p53 signaling pathway
    111851863
   04218 Cellular senescence
    111851863
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111851863
   04530 Tight junction
    111851863
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF913
Other DBs
NCBI-GeneID: 111851863
NCBI-ProteinID: XP_023682923
Ensembl: ENSPKIG00000005626
LinkDB
Position
Unknown
AA seq 294 aa
MEHQLLCCEVESIRRAYQDANLLNDRVLQTMLKAEDNYLPSANYFKCVQKDIVPYMRRIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKSRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRPSELLQMELLTLNKLKWDLASVTPHDFIEHFLSKLPIHQETKQILRK
HAQTFVALCATDVKFIASPPSMVAAGSVAAAVQGLHLKSTDSILSSQNLTDFLSQVIKSD
PDCLRACQEQIESLLESSLRQAQQQSHGASTDTKAAGDEADLSCTPTDVRDVNI
NT seq 885 nt   +upstreamnt  +downstreamnt
atggaacaccagctgctgtgttgcgaggtggagagcatcagaagagcctaccaagatgcc
aacttgctcaatgacagagttctacagacaatgctaaaagccgaggacaattaccttccc
tctgcaaattactttaaatgcgttcagaaagatatcgtgccttacatgaggagaattgtt
gccacgtggatgctggaggtctgcgaggagcagaaatgcgaagaggaggttttccccttg
gctatgaattatttggacagatttttgtctgtggaacccacaaaaaaatccagattacaa
ttactgggagctacgtgcatgtttctggcgtccaaaatgaaggagaccatcccgctaact
gcagagaaattgtgcatatataccgacaattccatcagacccagcgagttactgcaaatg
gaactactcacactgaacaaactgaaatgggacctagcctccgtaacaccccacgatttc
attgaacatttcctgtccaaactgcccatccaccaagagaccaagcagatcctccgcaag
cacgcccagacctttgtggctctctgtgcgacagatgtgaaattcatcgccagtccgccg
tccatggtggctgcgggaagcgtggcggcggcggtccaggggctgcacctcaagagcacg
gacagcattctgtcatcgcagaacctcaccgacttcctgtcgcaggtcatcaagagcgac
ccggactgcctgagggcgtgtcaggaacagatcgagtccctgctggagtccagcctgcgg
caggcccagcagcagagccacggcgcctccacggacactaaggccgccggagatgaggcg
gacctctcgtgcacacccacggacgtgcgggacgtgaacatctga

DBGET integrated database retrieval system