KEGG   Paramormyrops kingsleyae: 111851986
Entry
111851986         CDS       T05788                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04137  Mitophagy - animal
pki04210  Apoptosis
pki04218  Cellular senescence
pki04620  Toll-like receptor signaling pathway
pki04621  NOD-like receptor signaling pathway
pki04622  RIG-I-like receptor signaling pathway
pki04623  Cytosolic DNA-sensing pathway
pki04625  C-type lectin receptor signaling pathway
pki04920  Adipocytokine signaling pathway
pki05132  Salmonella infection
pki05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111851986
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111851986
  09143 Cell growth and death
   04210 Apoptosis
    111851986
   04218 Cellular senescence
    111851986
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111851986
   04621 NOD-like receptor signaling pathway
    111851986
   04622 RIG-I-like receptor signaling pathway
    111851986
   04623 Cytosolic DNA-sensing pathway
    111851986
   04625 C-type lectin receptor signaling pathway
    111851986
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111851986
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111851986
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111851986
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111851986
Transcription factors [BR:pki03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    111851986
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 111851986
NCBI-ProteinID: XP_023683175
Ensembl: ENSPKIG00000007574
LinkDB
Position
Unknown
AA seq 631 aa
MDVLCNWGLTTMSQGPPFLEIIEQPKQRGMRFRYKCEGRSAGSIPGENSNDTTKTHPAIK
VHNYTGPVHVRISLVTKNHPYKPHPHELVGKDCKHGFYEATLQDRRVHSFQNLGIQCVKK
KDVNDAISCRLQTQNNPFKIPEAEVWAEEFDLNAVRLCFQASITLPNSQLYSLQPVVSQP
IYDNRAPNTAELKICRIDRNAGNCRGGDEVFLLCDKVQKEDIEVRFFKDSWEDKGSFSQA
DVHRQVAIVFRTPPYSNPNLAEPVRVQIQLRRPSDREVSEPMDFQYLPVEPDEYRVMEKR
KRTEGMFQNLKLGNVVSGPTAGERRAINIARRTVTSKPHLSSRGQPVNPVVPNVPVQVQV
QAQAQTLFSSQPGHLFSAQPKAEATPSTESWQFQNNLPLASQNKAASVSSFSSPAPTTDP
ASAPTQKYHTVNLTDLYEFSFTGFSNSQESARTTASVTRGVDSLSGSRVWGVAAPTEPTT
SFGMLAPQFRADSQLCPEEDLPEFPSLTDGQVSSTLDSINTEDFQAMLSQSGQAGDVVGS
CMVTNMTPPRTSSSATDSLANHSSCRSTWMNYPSSIVTLLENEGMMDGPSATVSLSGPQD
DLAGMSSMDEEHLMSMFNNGTPACFMSGHPT
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggatgtgctgtgtaactggggtctgaccaccatgagccaaggccccccttttctggag
atcattgagcagcccaagcagagaggcatgagattcaggtacaagtgtgagggcagatca
gcaggaagcatcccaggagagaacagtaatgataccacaaagactcatcctgccattaag
gtgcataactacactggtcctgtccatgtgagaatctccttggtaactaagaaccacccc
tacaagccacacccccatgagctggttggcaaggactgcaaacatggcttctatgaggcc
acactgcaggacagacgtgtgcacagttttcagaacctgggaatacagtgtgtgaagaag
aaagacgtgaatgatgccatttcctgcaggctccagacacagaacaacccttttaaaata
ccggaggcggaggtgtgggcggaagagtttgacctgaacgcagtacggctctgcttccag
gcctccatcactctgccgaacagccagctgtactcactgcagcctgtggtgtcgcagccc
atctatgacaacagagcccctaacacagcagagctgaagatttgccgaattgacaggaat
gctgggaactgtcgaggcggggatgaagtcttcctactttgtgataaagttcagaaagag
gacattgaagtgcgattcttcaaagactcctgggaggacaagggctctttctctcaggcc
gatgttcaccggcaggtggccatcgtcttccgtacccctccctacagcaaccccaatctg
gccgagcctgtgcgggtccagatccagctgcggcgcccctctgaccgtgaggtcagcgag
cctatggacttccagtacctgcctgtggagccagatgagtacagggtgatggagaaaaga
aaacgcacggaaggaatgtttcagaatttgaagttgggcaacgttgtgtctggacccact
gccggagaaaggagggccatcaacattgccagaagaacagtgacgtccaagccacatctg
tcctccagggggcagccagtaaatccagtggttcctaatgtcccagttcaagtgcaggtc
caggcccaagcacaaacactgttcagctcccagccagggcatctgttctctgctcaaccc
aaagctgaggccacaccctccactgaatcctggcaattccagaacaatcttcccttggca
tctcaaaacaaggctgcctcagtgtccagcttctcctcccctgccccaactacagaccct
gcttctgcacccacccagaagtaccacactgtgaaccttaccgacctctatgagttcagc
ttcactggcttctccaatagccaggagtcggcgcgtaccactgcttctgtgaccaggggt
gtagacagcttgagtggatcaagggtatggggagtggcagctccgacagaacccaccacc
tccttcggcatgctggccccgcagtttagggcagattcacagctgtgcccagaagaggac
ctacctgaatttcccagccttactgatggccaggtgtctagcacactggacagcatcaac
acggaggacttccaggccatgctgagtcagagtggacaggcaggggatgtggtaggttcc
tgcatggtgaccaacatgacacccccaagaaccagctccagtgccactgactctttggct
aaccacagtagctgcagaagcacttggatgaactaccctagcagcatagtcactctcctg
gagaacgagggtatgatggatggcccctcggccacagtcagcctttcagggccccaggat
gacctggctggcatgagctcaatggatgaagagcatctcatgtccatgtttaacaacgga
accccggcatgctttatgtcagggcacccgacctaa

DBGET integrated database retrieval system