KEGG   Paramormyrops kingsleyae: 111852695Help
Entry
111852695         CDS       T05788                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00020  Citrate cycle (TCA cycle)
pki00190  Oxidative phosphorylation
pki01100  Metabolic pathways
pki01200  Carbon metabolism
Module
pki_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pki_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pki_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111852695 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111852695 (sdha)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111852695 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 111852695
NCBI-ProteinID: XP_023684651
Ensembl: ENSPKIG00000024753
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MAGVSAAARLFSRRVLHFQALPAVCRGSSRTFHFSIYGKKDNAKVSDGISTQYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEGDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENFGMPFSRTDDGRIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDG
TIHRFRAKNTVIATGGYGRTFFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGCGPEKD
HVYLQLHHLPPQQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGVPTNYKGQVI
THKDGADRVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAETCTPGEKLS
TLKPNAGEASVANLDKLRYADGSARTSEIRLNMQKTMQTHAAVFRTGSVLKEGCDKMAAV
YTTLDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTIEGALARKESRGAHAREDFKERVD
EYNFAKPLQGQQKKPFSEHWRKHTLSYVDPKTGKVTLEYRPVIDSSLNEEDCAAIPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgtatcagctgcagctcgactcttctccaggcgggttctgcatttccaggcc
ctccccgcagtctgtcgaggcagctctaggaccttccacttctccatctacggaaagaag
gacaacgctaaagtttcagatggtatctccacgcagtacccggtggtagaccatgagttt
gacgcggtggtggtgggggccggaggggccgggctgcgcgccgccttcggcctgtcggag
gccggcttcaacacggcctgcgtcaccaagctgttccctaccaggtctcacaccgtggcg
gcacagggtgggatcaacgcagctctcggaaacatggaaggcgatgattggcggtggcac
ttctacgacacggtgaagggctctgattggctaggagatcaggatgccattcattacatg
acagagcaggcaccagcagctgtgatagagctggagaacttcggcatgcctttcagtcgc
accgacgatgggaggatctaccagcgtgccttcggggggcagagcctgaaattcggcaag
gggggccaggcgcacaggtgctgctgtgtggccgacaggacgggccactccctcctacac
acgctgtatggcaggtccttgagatatgacaccagctacttcgtggaatactttgccctg
gacctgctgatggaggacggtgaatgcaagggagtgattgccctgtgcatggaggacggc
accatccatcgtttcagggctaagaacacagtcatcgcaactggtggctacgggcgaacc
ttcttcagctgcacgtcggcccacaccagcaccggggacgggaccgccatggtgacacgt
gcaggtctgccctgccaggacctggagttcgtgcagttccaccccacagggatctacggc
gccggctgcctgatcactgagggctgccgcggggaggggggcatcctcatcaacagcgag
ggcgagcgcttcatggagcgctacgcccccaacgccaaggacctggcatcccgggacgtg
gtgtcccgctccatgaccatcgagatccgcgagggcaggggctgcggaccagagaaggac
cacgtgtacctgcagctgcaccacctccctccgcagcagcttgccatgcgtctgcctggc
atctccgagaccgccatgatcttcgcgggcgtggacgtcaccaaggaacccatccctgtg
ctgccgaccgtccactacaacatgggcggcgtccctaccaactacaagggccaagtgatc
acccacaaggatggtgccgacagggtggtacccgggctgtatgcctgcggagaggctgct
tgtgcctccgtgcacggcgccaaccggctaggcgccaactccctgctggacctggtggtg
ttcggtcgcgcctgtgccctcaccatcgccgagacctgcactcccggtgagaagctctcg
accctgaagcccaatgccggggaggcgtctgtggccaacctggacaaactgcgatacgcc
gatggaagcgccagaacttcagagatccgactgaacatgcagaagaccatgcagactcac
gccgctgtcttccgcaccggttccgtcctcaaagagggctgtgacaagatggctgccgtc
tacacaactctggatgacattaagaccttcgacagaggcatcgtgtggaacacagaccta
gtggagaccctggagctgcagaacctgatgctgaacgccgtacagaccattgagggggcg
ttggcccggaaggagagccggggggcacacgccagggaggatttcaaggaacgtgtggat
gagtataacttcgccaagcccctccagggacagcagaagaagcctttcagtgagcactgg
aggaaacacacactgtcctatgtggaccccaaaactgggaaggtgactctggagtaccgg
ccagtgatcgacagctctctgaatgaggaggactgcgcagctatccctccggctatccgc
tcctactag

DBGET integrated database retrieval system