KEGG   Paramormyrops kingsleyae: 111852946
Entry
111852946         CDS       T05788                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04012  ErbB signaling pathway
pki04068  FoxO signaling pathway
pki04110  Cell cycle
pki04115  p53 signaling pathway
pki04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111852946
   04068 FoxO signaling pathway
    111852946
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111852946
   04115 p53 signaling pathway
    111852946
   04218 Cellular senescence
    111852946
SSDB
Motif
Pfam: CDI DUF4197
Other DBs
NCBI-GeneID: 111852946
NCBI-ProteinID: XP_023685116
Ensembl: ENSPKIG00000001375
LinkDB
Position
Unknown
AA seq 182 aa
MYFKLEGNERHSKVNSVRKTTPELKCRIMPINKPVLEALRTGPVRRNLFGQVDHEQMKKD
HEDLLQDDLKDKTCRWGFDFVGDVPLENHDFQWVALPEDQVPALYRPSVVRQGMARKLGA
VMENLEEEAEDDFESTSRTAAQNVERMPETKQKYAVKRKQTNITDYYQAKRRAVKTPRKS
GQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtatttcaaattggagggaaatgaaagacacagtaaagtaaatagtgtaagaaaaaca
acaccggaattaaagtgcaggatcatgcccatcaacaaaccagtcctggaagcactgcgc
actggcccagtccgccggaacctctttggccaggtcgatcacgagcagatgaagaaagat
cacgaggatctcctgcaggacgacctgaaggacaagacatgccgctggggcttcgacttt
gtgggggatgtgccacttgaaaaccacgacttccagtgggtggcgctgcccgaggatcag
gtcccggctctctaccgcccctctgtggtccgtcaaggcatggcacggaagcttggcgcg
gtgatggagaatctggaagaggaagctgaggatgactttgagagcacctcccgtactgca
gcccagaatgtagagaggatgccggagacaaagcagaagtatgcggtgaagaggaagcag
accaatatcacagattattaccaggccaagcgaagagcagtgaaaacgccacgcaagtca
ggccagtga

DBGET integrated database retrieval system