KEGG   Paramormyrops kingsleyae: 111853328Help
Entry
111853328         CDS       T05788                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111853328 (setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pki03036]
    111853328 (setdb1)
Enzymes [BR:pki01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111853328 (setdb1)
Chromosome and associated proteins [BR:pki03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111853328 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111853328 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF5604 Tudor_4 TUDOR_5 Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 111853328
NCBI-ProteinID: XP_023685849
Ensembl: ENSPKIG00000010963
LinkDB All DBs
Position
Unknown
AA seq 1264 aa AA seqDB search
MEDLEECVMDDLGVSLEELRHWIEEEVERSEVVRQRKAQLAELQDWVEQREREVAAVDSL
FSSASDSVMECETLVKDVYTKMGLVYKDSSSEDEGGGGGAQSSEVIEIDDDDDDDVIAVG
CVVPPQKGTTPSKDPAFNEASAALQRSSQQVQKLAQAVNKTTPTTTPTKPLPSTIVRRDV
SCQLSMPAVFVSQAPRNTPTQPNPALKEDEMKLEMSILGKKRTKTWHPGTLIAIIPVGTG
FKYKVKFENKGKSLLSGNHVAFNYHPTLERLYVGARVVAKYKDGNQVWLYAGIVAEMPNS
KNRMRFLIFFDDGYASYVSLPELYPVCRPLKKTWEDIEDASCRDFIEEYITAYPNRPMVL
LKAGQVIKTEWEGTWWKSRVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNLKVNCAN
TQEKRQGGQQRTRPNMAIRTKGPVVQYTSESNNMATSKNQGTSVNSKFPQSTTPGQHPRT
ESPDSLARSKQQVAKKSTSTFVAPPAAILRPPGPADTLVAGPRPLLSLPMPTPSPAAPAA
IVPSNNSRVFVLQPGSIQTLTPVSPITSLQPAPPPQLSYSCDRVPQEPSYQAPNERLFYL
LHTCSPACLSRVRPARLDQYRSRNPLLTPLLYEFRRMTGRRRVNRKMSFHVIYKSPCGLC
LRSMAEIQRYLFQTGCDFIFLEMFCLDPYVLVDRRFQPQKPFYFIQDITNGREDIPLSCV
NEIDGTPPPSVAYSKERIPADGVFINTSLDFLVGCDCTDGCRNKSKCACHQLTLQATACT
PGGQINTNAGYSYKRLEECLPTGVYECNKRCRCNPQMCINRLVQHGLQVRLQLFKTQNKG
WGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEA
HCSDSDGSGVDMSRVRVPGRSSQRKGYQKAEDDTNSGNGGQGDAQRGEDSSGDGEEDDDD
EEDDSNDDDDSSGENFIRNAYYSSSSVWRSYTTRRQAKGLKEGSQDSKDGLSVSTGGTEG
RKPPVMPEESGKSKVASWLTSQASSSGTQPAVKLEGLKTEKKEPLDQKPALGSISVKTET
GKKPPGSNMDVMTLSDSDDVQTISSGSDDKERERQAQGPLKRQVAVKSTRGFTLKSTHSL
VVKTGGGGGSGGTAGPGGAGGEGGLARKNTRQFFDGEESCYIIDAKLEGNLGRYLNHSCS
PNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGSTECR
GRLL
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atggaggacttggaggaatgcgtgatggatgacctgggtgtgtcactggaggagctcagg
cactggatcgaggaggaggtggaacgcagtgaggtggtgaggcagaggaaggcccagcta
gctgaactgcaggactgggtggagcagcgggagcgagaggtggctgctgtggactcgctc
ttcagcagtgcctctgattccgtcatggaatgcgagaccctcgtcaaggacgtatacacc
aagatggggctggtgtacaaggatagcagctctgaagatgaggggggaggcggcggcgcc
cagtcatctgaggtgatcgaaattgacgatgacgatgatgacgatgtcattgccgttggc
tgtgtggttccaccccagaagggcaccacaccatccaaggatcccgcgtttaacgaggcc
tctgccgcccttcagaggtcttcccagcaggttcagaagctggctcaggctgtgaacaag
acgaccccaaccaccactcccactaaaccgctgccttccaccattgtgcgccgagacgtg
tcgtgccagttgtccatgccggccgtgttcgtgtcacaagccccacgcaacacgcccact
cagcccaaccccgccctgaaggaggacgagatgaagctggaaatgagcatcctgggcaag
aagaggaccaagacgtggcacccgggcacgctcatcgccatcatccccgtcggaaccggc
ttcaagtacaaagttaagtttgagaacaaggggaagagcctgctgtcagggaaccacgtg
gccttcaactaccacccgacgctggagcggctctatgtgggcgcccgtgtcgtcgccaag
tacaaggacggcaaccaggtgtggctgtatgccggcatcgtggccgagatgcccaacagc
aagaaccgcatgaggttcctgatatttttcgacgacggttatgcatcctacgtcagtctg
ccggagctctaccctgtctgcagacccttaaagaagacgtgggaggacatcgaggacgcc
tcctgcagggacttcattgaggagtacatcactgcctaccccaaccggcccatggttctc
cttaaggctggtcaggtcatcaagactgagtgggagggcacctggtggaagagccgtgtg
gaggaggtggacggcagcctggtcaagatcctcttcctggatgacaaacgcagcgagtgg
atctaccggggttccacccgcctggagcccatgttcaacctgaaggtcaactgtgccaac
acgcaggagaagaggcagggcggccagcagcggactcgccccaatatggccattcggaca
aagggacccgtggttcagtacaccagcgagtcaaacaacatggcgaccagcaagaaccag
ggcacttcggtgaactccaaatttccacagtcaaccaccccagggcaacacccccgcaca
gagagtcccgacagtctggctcgatccaaacagcaggtagcgaagaagagcacctctacc
tttgttgcccccccggctgcgatcttgcgccccccgggccctgccgataccctggtggct
ggtccccggcctctgctctccctccccatgcccacgccctcccccgctgcccctgctgct
atcgtgccctccaacaattccagggtctttgtgctgcagccgggctccatccagaccctc
accccggtgtcccccatcacctccctgcagcctgccccacccccccagctctcatactcc
tgcgaccgagtcccccaggagccgtcctatcaggcccccaacgagcgcctcttctacctg
ctgcacacctgctcccccgcctgtctaagccgggtccggccagcccgcctggaccagtac
cgcagccgcaacccgctgctgacacccctactctacgaattccgccgcatgactggccga
cgccgcgtcaaccgcaagatgtcattccacgtgatctacaagtcgccctgtgggctatgc
ctgcgcagcatggcagagatccagcgctacctcttccagaccggctgtgacttcatcttc
ctggagatgttctgcctggacccctacgtgctggtggaccggcgcttccaaccgcagaag
cccttctatttcatccaggacatcacgaatggccgcgaggacatcccgttgtcctgcgtc
aacgagatcgacgggacccccccgcccagtgtggcttacagcaaggagcgcatcccggca
gacggggtcttcatcaacaccagcctggacttcctggtgggctgtgattgcaccgatggc
tgcagaaacaagtcaaagtgtgcctgtcaccagctgaccctccaggcaaccgcctgcacc
cctgggggccagatcaacacgaacgccggctactcctataagaggctcgaggagtgcctt
cccacaggggtatatgagtgtaacaagcgatgccgctgcaacccccagatgtgcatcaac
cggctggtgcagcacgggctccaagtgcgcctgcagctcttcaagacgcagaacaagggc
tggggcatccgctgcctggatgacgtggccaaaggctccttcgtctgtatctatgccggt
aaaatcctgacagatgactttgccgataaggaaggcctggagatgggtgatgagtacttc
gccaacctggaccacattgagagtgtggagaacttcaaagagggctatgagagcgaggct
cactgctctgacagtgatggcagcggggtggacatgagcagagttcgggtgcctggcagg
agctcgcagaggaaaggctaccagaaagctgaggacgacaccaacagtggcaacggaggc
caaggtgacgcccaaagaggtgaggactcctctggagatggggaggaagatgatgatgat
gaagaagatgactcgaatgatgatgacgacagctctggcgagaacttcatcaggaatgct
tactatagctccagctcagtgtggagaagctacactacacggaggcaggccaaggggctg
aaggaaggcagccaggacagtaaggatgggttaagcgtgtcaacaggagggacagagggc
aggaagccacctgtcatgccagaagagagcggcaagagcaaggtggcctcctggctgacc
agccaggcatcctcctctggcacgcagcctgcagtcaaactggaaggactgaagaccgag
aagaaggagccgctggaccagaagcctgcgctgggctccatctctgtgaagaccgagacc
ggcaagaagcctcctggaagcaacatggatgtcatgaccctctccgacagcgacgacgtc
cagaccatcagttctgggtctgacgacaaggagcgggagagacaggctcaggggccatta
aagaggcaggtggctgtcaagtctacccgtggattcaccctcaaatccactcatagcctg
gtggtcaagactggtggaggtggtggaagcggggggacagcgggacctgggggggcaggg
ggagaaggcggcctagctaggaagaacactaggcaattctttgatggcgaggaatcctgc
tacataatcgatgccaagctggagggcaaccttgggcgctatctcaaccacagctgtagc
ccgaacctctttgtgcagaacgtgtttgtggacactcatgacttgcgctttccttgggtg
gccttctttgccagcaagcggatacgggcggggaccgagctcacttgggactataactat
gaagtgggaagcgtggaaggcaaggagctgctgtgctgctgcggctccaccgagtgccgg
gggaggctgctgtag

DBGET integrated database retrieval system