KEGG   Paramormyrops kingsleyae: 111853451Help
Entry
111853451         CDS       T05788                                 

Definition
(RefSeq) probable cationic amino acid transporter
  KO
K13871  solute carrier family 7 (cationic amino acid transporter), member 14
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pki01009]
    111853451
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pki02000]
    111853451
Protein phosphatases and associated proteins [BR:pki01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111853451
Transporters [BR:pki02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   111853451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C PhoLip_ATPase_C
Motif
Other DBs
NCBI-GeneID: 111853451
NCBI-ProteinID: XP_023686119
Ensembl: ENSPKIG00000017967
LinkDB All DBs
Position
Unknown
AA seq 723 aa AA seqDB search
MNSIFARLHPGRVEWGDVLYRLQSRVLRTKPVDTMLDGSGADTHGTQLARVLTTVDLVSL
GVGSCVGTGMYVVAGLVAKEMAGAGVILSFCIAAMASILSGVCYAEFGVRVPKTTGSAYT
YSYVTVGEFVAFFIGWNLVLEYLIGTAAGASALSSMFDSLANHSISHFMIDHLGTLHGLG
KGEQSYPDVLALFIAALVTVIVALGVKNSVGLNNILNVVNLVVWVFIMIAGLFFVNPSNW
GDGRFLPHGWTGVMQGAATCFYAFIGFDIIATTGEEAKSPNTSIPYAITASLVTCLTAYV
SVSVILTLLVPYNKIDGDAPLMEMFVVHGFGFAKFVVAVGAVAGLTVSLLGSLFPMPRVI
YAMAGDGLLFRFLAHVSPFTETPVVACVASGSLAALLALLVSLRDLIEMMSIGTLLAYTL
VSVCVLLLRYQPDAGATTVTECPPEDEGGGEDEADGKMGDGPAFQQGSPYQGATTQDEYD
GMGDNACGAKNLPSGGDGEMLYDEGPDNICTALLRRLLGPRYHILRARLGLPGRTARPTP
ATGRIVTKSVLMLFVWAFLFFGAEREGGGWGVLSVLLMVPVAGSLLLVIMRQPENPRKLP
YMAPCVPLVPACAIIVNVYLMLKLSRITWIRFVVWCLLGLVIYFSYGMWNSNLELHAREE
EASASSYQRYDGGVDDSFGTEDAAPYPQDDDEPYQGWGAQQEGGYQQQYQAGPPQWDEGD
GRT
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaactccatctttgcccggctgcaccctgggcgggtggagtggggtgatgtgctgtac
cggctgcagtcacgggtcctgcggaccaagcctgtggacaccatgctggacggcagcggt
gctgacacgcacggcacgcagctggcacgtgtgctcaccaccgtggacctggtgtcgctt
ggcgtgggcagctgcgtgggcaccggcatgtatgtggttgccgggctggttgccaaggag
atggcgggggccggggtcatcctgtccttctgtattgccgccatggcatccatcctgtcc
ggagtgtgctacgccgagtttggcgtgcgcgtgcccaagacgacaggctccgcctacacc
tacagctatgtcacggtgggcgagttcgtggcctttttcatcggctggaacctggtactg
gagtacctgattggcacggcggccggtgccagcgccctcagcagcatgtttgactcactg
gccaatcactccatcagccacttcatgatcgaccatctgggcacactccatggcctggga
aagggtgagcagtcatacccagacgtcctggcactcttcattgccgccctggtcacggtg
atcgtggcgttgggcgtgaagaactcggtgggcctcaacaacatcctgaacgtggtgaac
ctggtggtgtgggtcttcatcatgattgcgggactcttcttcgtcaacccctctaactgg
ggtgatgggcgttttctaccccatgggtggacaggggtcatgcagggagctgccacctgc
ttctatgccttcatcggctttgacatcatcgccaccaccggcgaggaggccaaaagcccc
aatacatcgataccctatgccatcaccgcctcgctggtcacctgcctcaccgcctatgtc
tcagtgagtgtcatcctgaccttgctggtaccctacaacaaaatcgacggcgatgcacca
ctcatggagatgtttgtagtgcatggctttggctttgccaagtttgtggtggcggtgggc
gccgtggctgggctgaccgtcagcctcctggggtcgctcttccccatgccgcgggtcatc
tacgctatggctggcgatggcctgctcttcaggttcctggcacacgtaagtccgttcaca
gagacgccggtggtggcgtgcgtggcctcaggctcactggcagccctcctggcgttgctg
gtgagcctgcgtgacctgattgagatgatgtccatcggcacgctgttggcctacacgctg
gtctctgtgtgcgtgctgctgctgcggtaccagcccgatgctggtgccaccaccgtcacc
gagtgcccccctgaggacgagggtggtggcgaggatgaggctgacggcaagatgggtgat
gggccggcattccagcagggatcaccataccagggcgccaccactcaggacgagtacgat
ggcatgggtgacaatgcctgtggcgccaagaacctgccatcggggggcgatggtgagatg
ctgtatgatgaaggcccagacaacatatgcactgcactgctgcggcgccttctaggccca
cggtaccacatcctgcgggctcggctgggcctgcctggccgcactgccaggcccacaccc
gccacaggccgcattgttactaagagtgtgctgatgctcttcgtgtgggccttcctgttc
tttggtgctgaacgcgaaggtggcgggtggggggtgctctccgtgctgctgatggtgcct
gtggccggcagcctcctgttggtcatcatgcgacagcccgagaatccccgcaagctgccc
tacatggcaccctgcgtgcccctggtgccggcctgcgccatcatcgtcaacgtctacctc
atgctcaagctgtctcgcatcacctggatccgcttcgtcgtctggtgtttgctggggctg
gtaatctacttcagctacggcatgtggaacagcaacctggagctgcatgcccgcgaagag
gaggcgagtgctagctcgtaccagcgctacgacggcggtgtggatgacagctttggcaca
gaggatgcagccccctacccgcaggacgacgatgaaccataccagggctggggggcacag
caggagggcgggtaccagcagcagtaccaggcaggcccaccgcagtgggacgagggagat
gggcggacctag

DBGET integrated database retrieval system