KEGG   Paramormyrops kingsleyae: 111853698Help
Entry
111853698         CDS       T05788                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00562  Inositol phosphate metabolism
pki01100  Metabolic pathways
pki04068  FoxO signaling pathway
pki04070  Phosphatidylinositol signaling system
pki04115  p53 signaling pathway
pki04140  Autophagy - animal
pki04150  mTOR signaling pathway
pki04218  Cellular senescence
pki04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111853698 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111853698 (pten)
   04070 Phosphatidylinositol signaling system
    111853698 (pten)
   04150 mTOR signaling pathway
    111853698 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111853698 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    111853698 (pten)
   04218 Cellular senescence
    111853698 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111853698 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pki01009]
    111853698 (pten)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111853698 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     111853698 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     111853698 (pten)
Protein phosphatases and associated proteins [BR:pki01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    111853698 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 111853698
NCBI-ProteinID: XP_023686666
Ensembl: ENSPKIG00000025050
LinkDB All DBs
Position
Unknown
AA seq 425 aa AA seqDB search
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAEKLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERNYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVHYYSY
LLKNQLEYKPVALLFHKMVFETVPMFSGGTCRDTAVKNKTEQIPHGFKKGNWHWDPQFVV
YQLKVKIHTSNPTHTRREDKYMFFEFPKPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEETSEKVENGSLMKQMDGIQTTELGDGNRDYLTLVLTKNDLDKANKDKANRYFS
PNFKVKLYFTKTVEEPSNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEHHT
QITKV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatcataaaggaaatagtcagccgaaacaaaaggagataccaggaagatggc
tttgacttggacttgacctatatttatcctaacattatcgcaatgggctttcctgctgag
aaacttgagggtgtctacagaaacaacatagacgacgtagtacggtttctggattcaaag
cataaaaatcattataaaatatataatctatgcgcagagagaaattatgacgctgccaaa
tttaactgcagagttgcacagtaccccttcgaagaccacaatcccccccagctagagctt
ataaagcctttctgtgaagaccttgaccaatggctgagtgaagatgacaatcacgtcgca
gcgattcactgtaaagctgggaagggacgaaccggtgtcatgatctgtgcttacttgcta
caccgtggtaaattcctaaaagcacaagaagcgctagacttctatggcgaagtcaggacc
agggacaagaagggagtcacaatccccagtcagaggcgctatgtccactactacagctac
ctgttgaaaaaccagttggagtacaaacccgtggcgttactctttcacaagatggtcttt
gagactgttcccatgttcagtgggggcacatgtagggatactgcagttaaaaacaagact
gagcagattccacacgggttcaaaaaagggaattggcactgggatccccagtttgtggtc
taccagctgaaagtgaagatccacacctccaacccaacacacacacgacgtgaagacaag
tacatgttcttcgagttcccaaaacctctgcctgtgtgtggggacatcaaagtggagttc
ttccacaagcagaacaagatgatgaagaaggacaagatgttccacttttgggttaacact
ttcttcatacctggaccagaagagacttcagaaaaggtggaaaatgggagcttaatgaag
cagatggatgggattcagaccacagaactgggagatggcaatagggattacctaaccctg
gtgttgacaaagaatgatctggacaaggcgaataaagacaaggccaacagatacttctca
ccaaacttcaaggtgaagttgtactttacaaaaacagtggaggagccctcaaactccgag
gccagcacttcaacgtccgttaccccagacgttagtgacaatgaaccagatcactataga
tactctgacaccactgactctgaccccgaaaatgaaccctttgatgaagagcatcacaca
cagataacaaaagtctga

DBGET integrated database retrieval system