KEGG   Paramormyrops kingsleyae: 111855295
Entry
111855295         CDS       T05788                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04210  Apoptosis
pki04620  Toll-like receptor signaling pathway
pki04621  NOD-like receptor signaling pathway
pki04622  RIG-I-like receptor signaling pathway
pki04623  Cytosolic DNA-sensing pathway
pki04625  C-type lectin receptor signaling pathway
pki04920  Adipocytokine signaling pathway
pki05132  Salmonella infection
pki05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111855295
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111855295
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111855295
   04621 NOD-like receptor signaling pathway
    111855295
   04622 RIG-I-like receptor signaling pathway
    111855295
   04623 Cytosolic DNA-sensing pathway
    111855295
   04625 C-type lectin receptor signaling pathway
    111855295
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111855295
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111855295
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111855295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111855295
Protein kinases [BR:pki01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111855295
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 DASH_Spc19 KASH_CCD
Other DBs
NCBI-GeneID: 111855295
NCBI-ProteinID: XP_023689938
Ensembl: ENSPKIG00000016357
LinkDB
Position
Unknown
AA seq 600 aa
MVQPQGPLGSVLQWDMAGREVLGSSSQESLETASQGSAGVPELADSEVVQRLMGDNQKLR
DALRNSNIALRERCEEIKEWQQRLRAEKNVLGHRFQEAKNLVERLVRENQALQDQLRLMS
QRKSEEQSVPQAGKQLRNCHEPSEEAEGEEERIGEKQTGPQSLPMEGGNEVLKLLRNHKE
KLEERMRELKCRNETLLKEMEEGQNEMKNLRATNAQLQSRLGQVKGCGVTQEVLVCCDAQ
VTSSHSLPGPTAPVTPSTQLVQLSKQLQATQNRYKELQEKLDSLQKTSFQQDKNEMLLKQ
RENECAQLTKDCDMLKAQVTSLLGELREKQSCLEKSEEERARLEEKLNRVQEALQNMEQE
SKQMKSQHSVTVDTLRLQTQNLEMALKTERQVLTEDKRKLAQLQHAYTQLYQDYDSKLKN
ESQAKQRDGEVEDLARRLVEAEQALALKQDLIDKLKEEVEQQKGTLETVPVLTAQAEIYK
ADFLAEREAREKLHQRKEELQDKLNRTLAEMDRLRLEGTSRARMEEMQQRHIEDYRAAHT
LLPPMSGGFPGATIPFSPAQPPSFRMQNLSEELPDYRCPKCQYQAPDMDTLQIHVTDCID
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggttcagccccagggtcccttgggcagtgtgttgcagtgggacatggctggaagagag
gtgctgggatccagcagccaggagtcgcttgagacggcctcccagggctctgcaggagtc
cctgagctagctgacagtgaggttgtacagagactaatgggagacaatcagaagctgaga
gacgcattgaggaatagtaacatagctctgagggagagatgtgaggaaattaaggaatgg
caacagaggctgagggcagagaagaatgtcctgggccatcggttccaggaggcgaagaac
ttagtggagcggctggtccgggaaaaccaggcgctccaggatcagctcaggctcatgagc
caaaggaaaagcgaggagcagagtgttcctcaagcggggaagcagctccggaactgtcat
gagccatcagaggaagcagagggagaagaggaaaggataggggagaagcagacaggtcct
cagagcttgcccatggaagggggaaacgaggtcctgaagttgctgaggaatcacaaggag
aaactggaggagcgtatgcgagagctgaagtgccggaacgagacactgctgaaggagatg
gaggaggggcaaaatgaaatgaagaatctgcgtgctaccaatgctcagttacagtcaagg
cttggtcaggtgaagggctgtggagttacacaggaggtcctggtctgctgtgatgcacag
gtgaccagctctcacagcctgcctggacccacagcgcctgtgactccaagtacccagctg
gttcaactctccaaacagcttcaggcaacacagaataggtataaggagctgcaggagaaa
ctggattctcttcagaagacaagttttcaacaagacaaaaatgaaatgctcctgaagcag
agggaaaatgaatgtgctcagttgaccaaggactgtgacatgctgaaggcccaggtgacc
tcgctgctgggagagctccgtgagaagcagagctgcctggagaagagcgaggaagagagg
gcacggctggaagagaagctgaaccgggttcaggaggccctgcagaatatggagcaagaa
tcaaagcagatgaagagccagcacagcgtgacagtagacacacttcggctgcagacacag
aatctggagatggcgctgaagacggagagacaggttctcaccgaggacaagagaaagctg
gcccaactccaacatgcctacactcagctgtaccaagactatgactccaagcttaagaac
gagagccaggccaaacagagggatggtgaagttgaagacttggccagaaggctggtggaa
gcagagcaggctctggctttgaagcaggacctcattgacaaactgaaagaggaggtggag
cagcagaaagggacactggagaccgtacctgttctcactgcacaggcagagatttacaaa
gcagatttcctggctgagagggaagcccgggagaagctgcaccaacgaaaggaagagctt
caggacaagctgaaccgcaccctggctgaaatggacaggctccggctagaaggcacctca
cgtgctaggatggaggagatgcagcagagacacatagaggattaccgggcagcccacact
ctcctcccgcccatgtccggaggatttcccggcgccaccatccccttcagccctgcccag
cccccctcctttcgaatgcagaatctctctgaagagctgcctgattaccgctgcccaaaa
tgccagtaccaggcaccagatatggataccctgcagatccatgtcacagactgtattgac
tga

DBGET integrated database retrieval system