KEGG   Paramormyrops kingsleyae: 111856019
Entry
111856019         CDS       T05788                                 

Definition
(RefSeq) signal transducer and activator of transcription 3-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04068  FoxO signaling pathway
pki04217  Necroptosis
pki04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111856019
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111856019
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111856019
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111856019
Transcription factors [BR:pki03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111856019
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N Cas9_a Spectrin DUF496
Other DBs
NCBI-GeneID: 111856019
NCBI-ProteinID: XP_023691385
Ensembl: ENSPKIG00000019900
LinkDB
Position
Unknown
AA seq 766 aa
MAQWNQLQQLDPRYLEQLYHLYNDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQNLQSKYLEKPMEIARIVAHCLWEEQRLLQTAT
TASQDGQAIHPSGPVVTEKQQMLEHNLQDIRKKVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELTQDLNGNGQAAAVRLKMSQLEQMLSALDGLRRQMVTEMGGLLTAMEFVQKNMMEEE
LADWKRRQQIACIGGPPKICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDIFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDVASLRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRANSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLSTLAEKLLGPLVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGFIMGFISKERERAILN
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPDIAKEDAFGKYCRAEAIEQPDLTDPAHVQYLKTKFICVTPTNSG
NTSDLLLMSPRTLDSLMHNEGTEANPGPMESLTLDMELSSDVASPM
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggaccccagatatttggagcagctgtaccac
ttatacaatgacagcttccccatggaactgcggcagttcctggccccctggatagagagc
caggactgggcctacgctgccaacaaagaatcccacgccaccctggtgttccacaacctc
ctgggggagatcgaccagcagtacagccgcttcctacaggagaacaacgtcctctaccag
cacaacctgaggaggatcaaacagaacctccagagcaaatatttggagaagcctatggag
attgcccgcatcgtggcccactgcctatgggaagaacagcgcctcctgcagactgccact
accgcctcccaggacggccaggctattcatccatctggaccggttgtcactgagaagcaa
cagatgctggagcacaacctgcaggacatcaggaagaaggtgcaggacatggaacaaaag
atgaaaatgctggagaacctgcaggatgactttgacttcaactacaaaacgctcaaaagc
caaggagagctgacccaggatctgaacggtaacgggcaggcggcggccgtcaggctgaag
atgtcccagctggagcagatgttaagtgcactggatgggcttcgcaggcaaatggtgacg
gagatgggaggcttgttgacggccatggagttcgtgcagaagaatatgatggaggaggag
ctggccgactggaaaaggcggcagcagatcgcctgtatcggagggcccccaaaaatctgc
ttggatcgcctggagacctggatcacatccctggcggagtcgcagctgcagattcggcag
cagatcaaaaagctggaggaacttcagcagaaggtgtcctacaaaggagaccccatcatc
cagcaccgacctgccctggaggagaaaatcgtggacatcttcaggaacctaatgaagagt
gcttttgtggtcgagcgccagccatgtatgccgatgcatcctgaccggcctttggtcatc
aagacgggagttcagtttaccaccaaagtcaggttactggtgaagtttccagagctaaac
tatcaactaaaaattaaagtttgtatcgacaaagagtcgggtgatgtagcttctctgcgt
gggtctcgtaagttcaacatcttgggcaccaacaccaaggtgatgaacatggaagaatct
aacaacggcagcttgtctgcagagtttaagcacctgactctgagggagcagaggtgtggc
aacgggggccgggccaacagtgacgcctcactgatcgttactgaggagcttcacctcatc
acctttgagacggaggtgtatcaccagggcctcaagattgacctggagactcactctttg
ccagtggtcgtgatctccaacatctgtcagatgcctaatgcttgggcctccatcttgtgg
tacaacatgttgaccaatcaccccaagaacgtgaacttcttcaccaagccaccagtggga
acatgggaccaagtggctgaggtcttgagctggcagttctcctccaccaccaaaagagga
ctgaccatcgagcagctgtccacactggccgagaagctgcttggaccattagtgaactac
tccggatgccagatcacttgggcgaagttctgcaaagaaaacatggctggcaaaggcttc
tccttctgggtgtggttagacaacatcatagacttggtgaagaaatatattctggctctc
tggaatgaagggttcatcatgggcttcatcagcaaggagcgcgagagggcaatcctgaac
cccaagccacccgggaccttcctgctgcgattcagcgagagcagcaaagagggcggcatc
accttcacgtgggtggagaaggacatcagcggcaagacacagatccagtccgtagagccc
tacacaaagcagcagctcaacagcatgtccttcgcggacatcatcatgggctacaagatc
atggacgccaccaacatcctggtgtcgccgctggtgtacctctacccagacatcgccaaa
gaagatgcctttgggaagtactgcagagcagaagccatagagcagccagacttgactgac
ccggctcacgtccagtacttgaagacgaagttcatttgtgtgacacccactaattcaggt
aacaccagtgaccttctcctcatgtcaccccggaccctggactcgctgatgcacaacgag
gggactgaagccaaccctggcccaatggaatctcttactctggacatggaactcagctcc
gatgttgcctccccaatgtga

DBGET integrated database retrieval system