KEGG   Paramormyrops kingsleyae: 111856407
Entry
111856407         CDS       T05788                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00220  Arginine biosynthesis
pki00330  Arginine and proline metabolism
pki01100  Metabolic pathways
pki04020  Calcium signaling pathway
pki04146  Peroxisome
pki04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111856407 (nos2)
   00330 Arginine and proline metabolism
    111856407 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111856407 (nos2)
   04020 Calcium signaling pathway
    111856407 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111856407 (nos2)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111856407 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 Mo-nitro_C Diedel
Other DBs
NCBI-GeneID: 111856407
NCBI-ProteinID: XP_023692108
Ensembl: ENSPKIG00000009929
LinkDB
Position
Unknown
AA seq 1083 aa
MKVLQEENVKNTRQAQVIKRAAPGRCPFLHVRNLIDGSDCQDTLHHKAVKNQLCTSKVCE
NSKMTPKSLVVGPQKCPVSQNDILVQAIDFINQYYHSQKIAKPEDHLARVEAVVKEIDAT
GTYQLTMEELVFGAKQAWRNAPRCIGRIQWSNLQVFDARKCSTAREMFDFLCRHIEFATN
GGNLRSTITIFPQRGDTKHDFRVWNSQLVRYAGYHMSDGSILGDPANTEFTELCIQLGWT
PKYGRFDVLPLVLQANGEDPEVFEIPPELVLEVSMEHPQYEWFGDLQLRWYALPAVSNML
LEVGGLEFPACPFNGWYMGTEIGARDFCDPQRYDMLETVGSKMGLETDNPSSLWKDVALV
AVNIAVMHSFQKHNVTITDHHSASESFIRHMETEFQLRGGCPADWTWLVPPMSGSITPVF
HQEMVNYVLSPFFYYQPDAWLTHNWKNNVWRKGKLVSFKGLARMVLFCSTVMRRFIAQRV
RCTVIYATETGKSQSFAKKLNSMLNSAFNSRVLCMHEYNITDLEKESFLVVVTSTFGNGE
SPENGKSFWKHLYAVPCLRNKFRYCVFGLGSRMYPQFCAFARSVDTKLAALGAKRLTCMG
EGDELSGQDKAFIIWAKKAFADACQEFGISTQLDIRLPGMDQHTDDWDPRRYQLQHKKSS
QDHITALSAIHSKKILPMKLKRRQNLQSSQSSRATILVELESDGSAEGMQYLPGDHVGLF
PGNSTQLVTGILKHVADAPPSSQSVQLQYRSGTSANGDEGWQANDHIPACTLSQALTYFL
DITTPPSQNLLHKLSQLAGQEGHRQRLLKLSQDAEEYNSWKAFHKPTFLEVLEEFSSLEP
PATFLLSQLPPLKPRLYSISSSPELNPREIHLTVTVVNYHTQDGQGPMHHGVSSTWLNTI
KEGDMVPCFIRSSSDFHLPVEPSSPAILVGTGSGIAPFRGFWQQRLYDTQTKGVRGAPMT
LVFGCQSSDKDHIYKEETQQMMKNGVLNDVFPAYSRESGHPKMYVQDVLRERLEREVVRV
LHWEQGHLYICGNGRMVQDVTNTVQDILAKQLELNPSAAVEYMTQLKFEKRFHVDDFGAT
IRT
NT seq 3252 nt   +upstreamnt  +downstreamnt
atgaaagtacttcaagaagagaacgtgaaaaatacacgccaagcgcaggtgatcaagaga
gcggcccccggcaggtgcccgttcttacacgtccgcaacctgatcgacggttcagactgt
caggacactttgcatcataaagctgtcaagaatcagctgtgtacatcaaaagtatgtgag
aattccaaaatgacacccaagtccctggtggtggggccgcagaaatgccccgtgtcccaa
aacgacatcctagtgcaagccattgacttcatcaaccagtactaccactctcagaaaatt
gccaaacctgaagaccatcttgctcgtgtggaagctgttgtcaaggagatagatgccaca
ggaacctatcagctgaccatggaagagctggtgttcggggccaaacaagcatggcgaaac
gccccgagatgcattggcaggatccagtggtcgaacttgcaggtgtttgatgcgcgaaag
tgtagcacagcccgagaaatgttcgacttcctgtgcaggcacatagaattcgccacgaac
ggagggaacttgaggtctacaattacgattttcccccagagaggggatacaaagcatgac
ttcagagtgtggaacagtcagctggtgcggtatgctgggtaccacatgtcggacgggagt
attctaggcgatccagccaacactgagtttacagagctttgcatccagctggggtggaca
ccaaaatatggccgctttgatgtgctgcctctggtcctgcaagctaacggtgaagatcct
gaggtctttgaaattcctccagagctcgtcctggaagtctcaatggagcatcctcagtat
gagtggtttggggacctgcagctgaggtggtacgctctccccgccgtctccaacatgtta
ttggaggtggggggcctggagtttcctgcctgtcccttcaatggctggtacatgggcacg
gagatcggggcgcgggacttctgtgacccccagcgctacgacatgctggagactgttggc
agcaagatgggcctggagacagacaacccctcctcgctctggaaggacgtggccttagta
gccgtcaatatcgctgtcatgcacagcttccagaagcataatgtgaccatcacggaccat
cactccgccagtgagtccttcataagacacatggagactgagttccagctgcgggggggc
tgcccggctgactggacctggctggttccacccatgtccggctccatcacacctgtcttc
caccaggagatggtcaactacgtcctgtcacctttcttttactatcagccagatgcctgg
ttaacacacaactggaaaaataacgtgtggagaaaagggaaactcgtgtctttcaaagga
ctagccagaatggtactcttctgctccacggtgatgcggcgcttcattgctcagagggtg
cggtgtactgtaatttacgctacagagacaggcaaatcacagtccttcgccaaaaaactc
aactcgatgctgaacagtgccttcaattccagggtgctgtgcatgcatgagtataacatc
actgacctggagaaagagtcctttctggttgtggtaaccagcacctttggcaatggagaa
tccccagagaatggaaagagcttctggaagcatctttatgccgtgccgtgccttagaaac
aaattcaggtactgtgtgtttggcctgggctcccgcatgtacccacagttctgcgctttc
gcccggtctgtggacaccaagcttgcggctcttggggccaagcgcttgacatgcatggga
gagggcgatgagctgagcggacaggacaaagccttcatcatctgggccaagaaagccttc
gcggatgcctgccaggaatttggaatcagtacccagctggatatccggctgccagggatg
gaccagcacactgatgactgggacccaaggagataccagctgcagcacaaaaaatcctcc
caagaccacatcaccgccctctcagccatccactccaaaaaaattctccccatgaagctg
aagagaaggcagaacctccagagctctcagtcaagccgtgccactattctggtggagctg
gagagtgacggcagcgcagagggcatgcagtacctgcccggtgaccacgttgggcttttc
ccggggaactcgacgcagctggtcactggcatccttaagcacgttgccgacgcgcctccc
agcagccagagtgtgcaacttcagtatcgatcgggcacaagtgcaaatggagacgaaggc
tggcaggccaacgaccatatcccagcatgcactctgtcccaggcactgacctacttcctg
gacattaccacgcccccttcgcagaatcttcttcacaagctgtctcagctggcaggccaa
gagggtcatcggcagagactgttaaagctatctcaggacgctgaggagtacaattcctgg
aaagcatttcacaagcctaccttcttggaggttctggaggaattctcttccttagagccc
ccggcgactttcctgctcagccagctgcctcctttaaagccccgcctctattccataagc
tcctcccctgaactcaaccccagggagatccatcttactgtgactgtggtcaactatcat
acgcaagatggacaaggtccaatgcatcacggtgtctccagcacctggctgaacaccatc
aaggagggagacatggtgccttgctttatccgcagctccagtgattttcacctcccagtg
gagcccagctctccagccatcctagtggggacgggcagtggcatcgcccccttcaggggc
ttttggcaacagcggctgtatgacacgcaaactaaaggtgtgagaggtgcacccatgaca
ctagtgtttggttgccaaagttcagacaaagaccacatctacaaagaggaaacccagcag
atgatgaagaatggggtgctcaatgacgtctttcctgcatattctcgtgaatctggccac
cctaagatgtacgttcaagatgtcttgagggaaaggttggaacgggaagtggtgagggtc
ctgcactgggaacagggacatctctatatctgtgggaatggaaggatggtccaggatgta
accaacacagtgcaggacatcctggcaaagcagctggaattgaatccctccgctgctgtg
gaatacatgacccagcttaagttcgagaagaggttccatgtagatgactttggggcaacc
attcggacataa

DBGET integrated database retrieval system