KEGG   Paramormyrops kingsleyae: 111857846
Entry
111857846         CDS       T05788                                 

Gene name
tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04060  Cytokine-cytokine receptor interaction
pki04068  FoxO signaling pathway
pki04144  Endocytosis
pki04218  Cellular senescence
pki04350  TGF-beta signaling pathway
pki04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111857846 (tgfbr2)
   04350 TGF-beta signaling pathway
    111857846 (tgfbr2)
   04068 FoxO signaling pathway
    111857846 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111857846 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111857846 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    111857846 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111857846 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111857846 (tgfbr2)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111857846 (tgfbr2)
Protein kinases [BR:pki01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111857846 (tgfbr2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr ecTbetaR2 Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 111857846
NCBI-ProteinID: XP_023694816
Ensembl: ENSPKIG00000014556
LinkDB
Position
Unknown
AA seq 545 aa
MDVWRVCFSVFALAIAQFPVHLAMHHLPANRLNNLCKFCDLKTSDCDGKSECLTNCNITS
TCALEEEVCVSIWRKKENNNTVETLCHDPSKKLYGLFLTDYNNTKCVMKEKVSQGSSIHI
CSCSNEEECNEILFFHTHQDPPEDVQVDWVILISLLPLLVLAVLVITIFYMYRVYRRRQL
QSKKLRHKDQLDHSDTGPIMPDDRSDSSSTHANNLNHNMEPLPIELDVQVGKGRFAEVYK
AKLKQSPSEQFETVAVKIFPEEEYASWKNEKDIFSDMNLKHENILHFLTAETRKVQKQYW
LITAYHPRGNLQEYLTRHIITWQDLWLLGESLARAVAHLHSDHTPCGRPKVPIVHRDLKS
SNILVKKNLTCCLCDFGLALRLDNSLSVDDLANSGQVGTARYMAPEVLESRINLENTESF
KQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGSKVREHPCVESMKDNVLRDRERPEIPN
SWVNHQGIQMVCSTITECWDHDPEARLTAQCVVERFGETEHLDKLSTRSCSEEKIPEDCS
VSDGK
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggatgtctggagggtctgtttttccgtcttcgccttggccatagcgcagttccccgtc
cacctcgccatgcaccacctgcctgccaacaggttaaacaacctctgcaagttctgcgac
ttgaagacctcggactgtgacggcaagagcgagtgcctgaccaactgcaacatcacgtcc
acctgtgcgctcgaggaggaggtctgcgtcagcatctggagaaaaaaggaaaacaacaat
acagtggagacactttgccacgacccatccaaaaagctgtacggtctgttcctgaccgac
tacaacaacaccaaatgtgtgatgaaggagaaggtctcccaaggcagcagcattcacatc
tgctcctgctccaacgaagaggaatgcaatgaaattctcttctttcacacccatcaagat
ccccctgaggacgtccaggtggactgggtcatcctcatcagcctgctgcctctgcttgtc
ctggcggtgctggtcatcaccatcttctacatgtacagggtgtatcgccggcgtcaactc
caaagcaagaagctgagacacaaagatcagctggaccacagcgacaccggccccatcatg
cccgacgaccgctccgacagcagctccacccacgccaacaacctgaaccacaacatggag
ccactgcccatcgagctggacgtccaggtgggcaaaggccggttcgccgaggtctacaag
gccaagctcaagcagagtccctcagagcagtttgagacggtggcagtcaagatcttccca
gaagaggagtatgcgtcctggaaaaacgagaaggacatcttctccgacatgaacctgaag
cacgaaaacatcctgcacttcctgacagccgagacccgcaaggtgcagaaacagtactgg
ctcatcacggcctaccacccccggggtaacctgcaggagtacctcacccgtcacatcatc
acctggcaggacctctggcttctgggggagtccctggccagggctgtagcccacctgcac
agcgaccacaccccgtgcgggcgccccaaggtccccatcgtccaccgggacctaaagagt
tccaacatcctagtcaagaagaacctcacctgctgcctgtgtgactttggccttgctcta
cgtttggacaattcgctgtctgtggacgaccttgccaacagtggacaggtgggcactgcc
agatacatggctccagaggtcctcgagtccagaatcaacctggagaacacagagtccttc
aagcagaccgacgtctactccatggccctggtgctgtgggaaatcacctccagatgtaac
gccattggcgaggtgaaggactacgagccaccgttcggctccaaagtccgggagcatccc
tgtgtggagagcatgaaggacaacgtcctgcgggaccgggagcgcccggaaatccccaac
agctgggtcaaccatcagggcatccagatggtatgctccaccatcacagaatgctgggac
cacgaccctgaggcccggctaacggcacagtgcgttgtcgagagattcggcgaaaccgag
cacctggacaagctgtcgacgcgctcctgctccgaggagaagattccggaggactgctcc
gtgagcgacgggaagtag

DBGET integrated database retrieval system