KEGG   Paramormyrops kingsleyae: 111858596
Entry
111858596         CDS       T05788                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04012  ErbB signaling pathway
pki04068  FoxO signaling pathway
pki04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111858596
   04068 FoxO signaling pathway
    111858596
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111858596
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111858596
NCBI-ProteinID: XP_023696272
LinkDB
Position
Unknown
AA seq 185 aa
MSDVRLSSSPTLERMDVRLSDHSKSRACRCLFGPIDHGELKKDQQELQRLQEETAARKWN
YDFARDRPLAGGAYDWTAVNSCDLPEFYSRGHPGAGVALPSASAADADLRGQSHCQEGDA
KGSAEAAEKPDEQMDYRNPREKSITRKRPGSKESPSQSKKSRRLLGESSQCSAVPLEVTP
RKSKT
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcagatgtccgtctctcgagtagccccacgctggagaggatggacgtccggctgtcc
gatcattcgaagtcccgggcttgccggtgcctcttcggtccaatcgatcacggcgagttg
aagaaggatcagcaggagctccagcggctccaggaggaaacggcagctcgaaagtggaat
tacgactttgccagggaccggccgctggccggcggcgcctacgactggacggcggtgaac
agctgcgacctgccagagttttacagccgggggcatcccggcgctggagtcgcactcccc
tcagcgagcgccgccgacgcggatctacgaggccagagccactgtcaggagggcgacgcg
aaagggtcagcggaggcagctgaaaagcctgacgagcagatggattatagaaacccgcgg
gagaaatccatcacaaggaaaagacctggaagcaaagagtccccttcacagagtaaaaaa
tcacgcaggcttttgggcgagagcagccagtgttcggcggtgccgctggaagtgacaccg
aggaagtccaaaacgtga

DBGET integrated database retrieval system