KEGG   Paramormyrops kingsleyae: 111858733Help
Entry
111858733         CDS       T05788                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00480  Glutathione metabolism
pki00980  Metabolism of xenobiotics by cytochrome P450
pki00982  Drug metabolism - cytochrome P450
pki00983  Drug metabolism - other enzymes
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111858733
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    111858733
   00982 Drug metabolism - cytochrome P450
    111858733
   00983 Drug metabolism - other enzymes
    111858733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pki02000]
    111858733
Enzymes [BR:pki01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111858733
Transporters [BR:pki02000]
 Other transporters
  Pores ion channels [TC:1]
   111858733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 111858733
NCBI-ProteinID: XP_023696520
Ensembl: ENSPKIG00000001946
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MASQKCLVQGCQAPGPVTNSQIRIYSMRFCPFAERTRLVLNAKGINYEVINIHLKNKPSW
FFEKNPAGTVPVLETVQGQLICESPITCEYLDEMFQDKKLFPADPFKKAQQKMLLEEFSK
VVPFFYKIPIGKSKGEDTSAEEEELKGKFIKLNEVLVGRKTKFFGGDSLTMIDYLMWPWF
ERVDGYGVARLLDAAPALKEWMKRMVEDPTVKATMFDGETHKAFLKSFFDGKPNYDLGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacagaaatgtctcgtccaaggatgccaagctccgggtccagtgaccaattcc
caaatccgcatatacagtatgaggttctgcccctttgctgaaaggacgcgtttggttctc
aacgccaagggtatcaactatgaagtcattaacatccatctgaagaacaaacctagttgg
ttctttgaaaaaaatccagcgggtaccgttccagttttggaaactgtgcagggtcagctg
atctgtgaatcaccaatcacgtgtgagtacctggatgaaatgtttcaggacaagaagctc
tttcctgctgacccatttaagaaggcccaacagaagatgctgcttgaggagttctccaag
gttgttccatttttttataaaatccctattgggaagagcaagggtgaggatacgtctgcc
gaggaagaagaactgaaagggaaattcataaaactcaatgaggttctagttggcaggaag
acaaagttttttggaggagattctttgactatgattgattacttgatgtggccttggttt
gagagggtggatggctatggagtggcacgcctcttggatgcagccccggcgctgaaggag
tggatgaagcgtatggttgaggatccaactgtcaaggcaaccatgtttgatggcgagacc
cacaaagcttttctcaagagcttctttgatggcaaacccaactatgacttaggcctgtag

DBGET integrated database retrieval system