KEGG   Paramormyrops kingsleyae: 111859433Help
Entry
111859433         CDS       T05788                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B-like
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111859433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pki03036]
    111859433
Enzymes [BR:pki01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111859433
Chromosome and associated proteins [BR:pki03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111859433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 111859433
NCBI-ProteinID: XP_023697840
Ensembl: ENSPKIG00000003691
LinkDB All DBs
Position
Unknown
AA seq 843 aa AA seqDB search
MKWPGESKTMVLNGRQTGSRFCSGRPPSRPQPLRQGKHPPGTRRCSRRFGTAPLEAERRY
VPSSGMSAKELCENDDLSTCLILDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFKKHDN
LEKAFQALTTGEWAQHYCLHKTKAQEKLFKEHVFIYLRMFAADSGFEILPCNRYSSEQNG
AKIVATKEWKRNDKIEYLVGCIAELSESEENMLLRHGENDFSVMYSTRKNCAQLWLGPAA
FINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGESNEFCECYTCERRGT
GAFKSKAGPLPATPVINSKYGLRETDKRLNRLKKLDEGSKNSNGQSVGTDADTQGTRGAH
TSSRKRTSTGVKKFSRTWSLTRQSLSRAPTSTSSCKQSHRNRSRVPKRLRSRPTKTSLAK
ARLRSRCRGSEQRAQSKVSVGNLGLKEPKVVLCKAVSGKNEGDAGGEGRVEEQRGCLTRH
TTKENSHAADVALCEGTLSCTYRTRQSTRTQLTAQGCSGIKLQPDPLDAHGPVNGGVVVK
TEPADLEEYMEHGLQLNGHGLEVGCPKKGACPQRRQLSQSKLDRTIKSEERDPYREASFR
EGIPDLRHAARAADMADCGRVQLGLHEQRQDCSGTTGLLRREKAKGSYRTAGKGKKKRPI
TRYDAQLILQNNSGIPKLTLRRRRDNSGGKASEPGASSPTRSSSKISIKFSKDHEKDKSS
SYVAQLNNGFSAGGHGSPTKLKIQLKREDEFREGAQEHLDKVTSSGVSTRAVRDGPERRP
AVHRTQRADAESSSEGDCFDDEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLR
LNA
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggccgggagaatccaagaccatggtgctgaacggcagacagaccggcagccga
ttctgcagtgggcgtcccccgagccggccccagccgctgcggcagggcaagcacccccct
ggcacccgcagatgtagcaggcgttttggcactgcacccctggaggcggagagacgctat
gtcccctcctctggaatgagtgccaaggagctatgtgagaatgatgacctcagcacctgc
ctcatcctcgacccctatctgggtttccagacccacaagatgaacactaggtttcggcct
attaagggaaggcaggaggagctgaaggaggtgatagagcgcttcaagaagcatgacaac
ctggagaaggctttccaggccttgactactggggaatgggctcagcactactgcctgcac
aagaccaaggcccaggagaagctcttcaaagagcatgtgttcatttatttacgcatgttt
gcagcggatagtgggtttgaaatccttccttgtaaccggtactcttcggagcaaaatgga
gccaaaatcgtcgcgactaaagagtggaagaggaacgataagatcgagtacctggttggc
tgtatcgccgagctgtcggagagcgaggagaacatgctccttcgtcacggggaaaacgat
tttagcgtcatgtattccacccgcaagaactgcgcccagttgtggctggggcccgccgcc
ttcatcaaccatgattgtcggccaaattgcaaatttgtctccactggtcgggacacggca
tgcgtcaaggtcctgagggacatcgagccaggggaggagatttcttgttactacggcgac
ggcttcttcggggagagcaacgaattctgtgaatgctacacctgtgaaagaagaggaaca
ggtgcttttaaatcaaaagccggacctctccctgccacacccgtcatcaacagcaagtat
gggctgagagagacggacaagcgtctcaacaggctgaagaaactggacgaaggaagcaaa
aactccaacggccagtctgtgggcacggatgccgacactcagggaacacgcggcgcacac
acatcgtcaaggaaaaggacatccaccggtgtgaaaaagtttagcaggacttggtctcta
accaggcagtctctctcgagagctcctacttctacctcatcgtgtaaacagagtcatagg
aatcgttcaagggtaccaaagagactaagatcaaggcctacgaagacttcgcttgctaag
gccaggctgaggagtcgctgccgagggtctgagcagagggctcagagcaaggtgagcgtt
ggtaacttgggtttgaaggagcccaaggtagtcctttgtaaggccgtctcggggaagaac
gagggagacgcagggggagaagggagggttgaggagcagagggggtgcttaacccggcac
acaacgaaggaaaacagtcacgccgcagatgtcgctctgtgcgaggggaccttgtcttgt
acttacagaactcgacagtccacacggacccagctaactgctcaggggtgctctggcatt
aagctccagcctgatccgcttgatgcccacgggccagttaatggcggcgtggtcgtcaag
accgagccggcggatttggaggagtacatggagcatgggcttcagctgaatggtcatggc
ctggaagtgggctgccccaagaagggagcctgcccacagcgaaggcagttgtctcagtcc
aaactggacaggaccatcaagtcggaggagagggatccctacagggaggcctccttccgg
gaaggtatcccagatctgcgccatgctgcccgggctgccgacatggcagattgtggcagg
gtgcagttaggcctccacgaacagcgccaggactgtagtggcaccaccggtctcctgcgc
cgggagaaggccaaaggaagttaccggacagcgggaaagggcaagaagaagcggcccatc
actcgttacgacgcgcaactcatcctgcagaataactctggcatccccaagctgactctg
cggcgacggcgagacaacagcgggggaaaggccagcgagcctggagccagcagtcccaca
cgcagctcctccaagatcagcatcaagttcagcaaggaccacgagaaggacaagagcagc
tcttatgtggctcagctcaacaacggcttcagtgccggagggcacggcagccccaccaag
ttgaagattcagctgaagcgtgaggatgagttccgggagggcgcccaggagcacctggac
aaggtcacctccagcggagtctctacgcgggccgtgcgagatggtcctgagcgccgacct
gcagtgcacaggactcaacgcgccgatgcggaatcttcatcagagggggactgctttgat
gacgaatttgaggatgacttcattccccttccaccagctaaacgtcttcgcctcattgta
gggaaggactccatagacattgacatctcctctaggagaagagaggatcagtctctaagg
ctcaatgcttaa

DBGET integrated database retrieval system