KEGG   Paramormyrops kingsleyae: 111859998
Entry
111859998         CDS       T05788                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pki  Paramormyrops kingsleyae
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 111859998
NCBI-ProteinID: XP_023698999
Ensembl: ENSPKIG00000024251
LinkDB
Position
Unknown
AA seq 372 aa
MSQDEMIELQALTPEGYIELVAPRPVTGRQHDSERVRAVRLVDGGLCWEGPGEGHAFEPC
SLAQPTWCDLCGEFIWGLYKQSLRCTLCRFTCHYRCRAFIKLDCSWKGGALANQSDLAED
SVEADTNVDEPMEWRVGELSFTELQQKVREFNAQVNRDLYIVLNKDGSFTGVIKVWVRLK
CSMSVPSQGMRPRLCSSYQLDTAMPLHISSSTQAHDIVRALLSTFGVTGNPGEFALFEHR
EPSDQVYQRKLEGSERPLLLRICAGPSEKSLSLVLKENSPGEINWEAFTEPELRNFLHIL
QFEEEEHIRQIVEGYACARDHLQEALASITQTDMTHVSEQRHQGAPRIQKSYKLRYVRSE
FEGMSDLTTMNW
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtctcaggatgagatgatagagctgcaggccctgacaccagaggggtacatcgaactg
gtggccccccgccccgtgacagggcgacagcacgactcagagagggtgcgggccgtgcgg
ctggtggatggtggcttgtgttgggaggggccaggggagggccacgccttcgagccctgc
agccttgcccagcccacttggtgtgacctgtgtggagaattcatctgggggttgtacaaa
cagagcctgcgctgcacactctgcagattcacttgccactaccgctgcagagccttcatc
aagttagactgcagctggaaaggcggggccctcgccaaccaatcagatttggcggaggac
tcagtggaggcggacaccaatgtggatgagccaatggaatggagggtaggcgagctgtcc
ttcactgagctccagcagaaggtgagggagttcaacgctcaggtcaacagagatctctac
atagtcctgaataaagatggctcctttactggtgtcatcaaagtctgggtcagactgaag
tgctccatgtctgtgccaagccagggtatgaggcctaggctctgcagctcctatcagctg
gacacagccatgcccctgcacatcagctcgtccacccaggcccatgacattgtccgcgcg
ttgcttagtacatttggtgtgacaggcaaccctggcgagtttgccctatttgaacacaga
gagccgagtgaccaagtgtaccagaggaagttggagggttcagagcgccccctgctgctg
cggatatgtgctggccctagtgaaaagtccctcagcctggtgctgaaggagaacagccct
ggtgagatcaattgggaagctttcactgagccagagctacgcaacttcctacacatcctg
cagtttgaagaagaggagcacatcaggcaaatagtggaaggttatgcctgtgctagggac
cacctgcaggaggcgctggcaagcatcacacagactgatatgactcatgtgtctgaacag
cgccatcagggggcacccagaatccaaaaatcatacaaattgcggtatgtacgtagtgaa
tttgagggaatgagtgacctaacaaccatgaactggtga

DBGET integrated database retrieval system