KEGG   Paramormyrops kingsleyae: 111860952
Entry
111860952         CDS       T05788                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111860952
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111860952
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pki04052]
    111860952
Cytokines and growth factors [BR:pki04052]
 Growth factors
  Growth factors (RTK binding)
   111860952
SSDB
Motif
Pfam: SCF CCDC144C HSBP1 CENP-F_leu_zip DUF4371 Mito_fiss_reg
Other DBs
NCBI-GeneID: 111860952
NCBI-ProteinID: XP_023700899
Ensembl: ENSPKIG00000011227
LinkDB
Position
Unknown
AA seq 255 aa
MKKAKIWIVTFVHLLFSSSCFAPSSEIRHIITDDDKIISLLKQNIPKDYRMAVCFIPKEL
SHMCWVQLNVYHLEGSLKVLQDKFGDISSNRDNLSIVIRRLQDMRVKIEYLESMMQDFAC
HYREESWVAEHYFDFVQDLLKSNTYEMKSEDCESPPCPPSTPPTTPTGSPEQDPNKISCN
VSTTDCDKQAQAQHISEVVGKSLLILLLIPTAALIFFIYWKIKHRKEEPPKRPAEHEKLF
DTILQAATPPVDQEC
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaagaaggcaaaaatttggatagtcacttttgtgcatttattgttctccagttcatgt
tttgctccatccagtgaaatcagacatatcattacagatgatgacaaaataatctctctg
ttgaagcagaatattcccaaagattacaggatggctgtctgtttcatccccaaggaattg
agccacatgtgttgggttcaactcaatgtatatcacttggagggaagcttaaaagttttg
caggacaagtttggggacatttcatccaacagggacaatctcagcattgttatccgaaga
ctacaagacatgcgggttaaaattgaatacctggagtcaatgatgcaagacttcgcctgc
cattacagagaagaatcttgggtggcagagcattattttgactttgttcaagacttatta
aaatctaacacttatgaaatgaaatctgaagactgtgaatcgcccccctgtcccccatca
acccctcccaccactccaacaggatctcctgagcaggatccaaataagatcagctgtaat
gtttcaacgacagactgtgataagcaagcacaggctcagcatatatcagaagtagttgga
aaaagtctcctaatcttactactaattcctacagctgctctcatatttttcatatattgg
aagatcaaacacagaaaagaggaacctccaaagaggccggctgagcacgagaagctgttt
gataccatcctgcaagcagctacgccaccagtagaccaagaatgctag

DBGET integrated database retrieval system