KEGG   Plasmodium knowlesi: PKH_061930Help
Entry
PKH_061930        CDS       T01094                                 

Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pkn  Plasmodium knowlesi
Pathway
pkn00020  Citrate cycle (TCA cycle)
pkn00190  Oxidative phosphorylation
pkn01100  Metabolic pathways
pkn01110  Biosynthesis of secondary metabolites
pkn01130  Biosynthesis of antibiotics
pkn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pkn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PKH_061930
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PKH_061930
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PKH_061930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO Lycopene_cycl GIDA FAD_binding_3 HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 7319682
NCBI-ProteinID: XP_002261868
UniProt: A0A384LJT6
LinkDB All DBs
Position
6:complement(878162..880063)
Genome map
AA seq 633 aa AA seqDB search
MLTIRRKCYPAFARATRLNFSSVKKKAYEIVDHHYDAVIVGAGGAGLRSALELSKNNYKV
ACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAP
ASVLELEEFGLPFSRTKSGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQ
SLAHNCVFFVEYFVLDLLMASPNECIGVICLNIADGKIHRFFSPHTVIATGGYGRAYLSC
TSAHACTGDGNAIVSRSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAF
MMRYAPKAKDLASRDVVSRAMTIEINEGRGCGPNADHIYLDLTHLPYETLKERLPGIMET
AKIFAGVNVTNQYIPVLPTVHYNMGGIPTNYKTQVLTQKVNLSKGVKTSQDDDIIVKGLY
AAGEAASASVHGANRLGANSLLDIIVFGKRASLTIMEIDKPNIPPIKAHADIGDETIERL
DKIRFNKGTISTAQIRKKMQVCMQKHAAVFRIGPLLEEGYKQILNICSQFNDVYVKDKTL
TWNTDLLETLELENLLTLASQTILAAIDRKESRGAHARDDFPERDDKAFLKHSLTWMTDR
DVEKSKFFTTYRGVITKPLDNEMEHVPPVKRVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccatccgtcgcaagtgctaccccgccttcgcgcgtgcgacccggcttaacttt
tcaagtgtgaaaaagaaagcgtacgaaattgtggaccaccattacgatgcggtgatagtg
ggcgcaggaggagcgggacttcgctccgcattggagttgtccaaaaataattacaaagta
gcatgtataagtaagctattcccaacaagatcacacaccgtcgcagcgcaagggggtata
aatgccgcattagggaatatgactgaagatgactggaggtggcatgcctacgatacgatt
aaaggatccgactggctaggggaccaaaatgcaattcaatatatgtgtcgagaagcacct
gcatctgttcttgagctagaggaatttgggctacccttttctagaaccaaatcaggaaaa
atctatcaaagagcatttggagggcaaagcttaaaatatggaaagggaggacaagcatac
agatgtgcagctgccgcagatagaacaggtcatgcaatgcttcataccttgtatggtcaa
tcattagcacacaactgcgttttcttcgttgaatattttgtactagatctgttaatggct
tctccaaatgaatgcattggtgttatctgcttaaatatagctgatgggaagatacatagg
tttttttcaccgcatacagtaattgctactgggggatatggtagagcttacttgtcttgc
acgtcagcacatgcatgcacaggtgacggaaatgcaattgtttcgaggagtaagctacca
ttgcaagatcttgaatttgtccagtttcaccctacaggaatatatccagctgggtgctta
attactgaaggatgtagaggtgaaggaggcatactgaggaatagggaaggagaagcattc
atgatgagatatgctcctaaggccaaagatttggctagtcgagatgtagtcagtagagct
atgactatagaaataaatgaaggtagaggttgtggccctaatgcagaccatatctacctg
gacttaacacatttaccttacgaaaccttgaaggaaagactaccaggtataatggaaaca
gccaaaatatttgcaggcgttaacgtcaccaatcaatacatacctgtacttccaaccgta
cattacaacatgggaggcataccaaccaattataaaacgcaagttttaacacagaaggtt
aatttatctaaaggggtaaaaacatcacaagacgatgatataattgttaaagggttatat
gcagcaggagaggcggcatctgcatctgttcatggggcaaaccgattgggagctaattct
ctcctagacattatcgtcttcggaaaaagggcttcgctaaccattatggaaattgataaa
ccaaatattccccccattaaggcgcatgcagatataggggatgaaaccatagaacgccta
gacaagataagattcaacaaaggaacaatttcaacagcacaaatacgtaaaaaaatgcaa
gtgtgcatgcaaaaacatgccgccgtttttagaattggacccctcctcgaggaaggctac
aaacagatacttaatatctgctcccagtttaatgatgtgtacgttaaggacaaaacctta
acatggaatactgatttgcttgaaacattggaattggagaatttactaaccttggcctct
caaaccattttagccgccatagatcgaaaggaatccagaggtgcgcatgcaagggatgac
ttcccagaacgagatgataaggcctttcttaaacactccctaacttggatgactgacagg
gacgttgagaagtcgaagtttttcactacctacaggggcgtaatcaccaagccactggat
aacgaaatggagcacgtcccgccggtcaaaagggtttactga

DBGET integrated database retrieval system