KEGG   Plasmodium knowlesi: PKH_143330Help
Entry
PKH_143330        CDS       T01094                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
pkn  Plasmodium knowlesi
Pathway
pkn00564  Glycerophospholipid metabolism
pkn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pkn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PKH_143330
Enzymes [BR:pkn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     PKH_143330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C Ribos_L4_asso_C
Motif
Other DBs
NCBI-GeneID: 7323256
NCBI-ProteinID: XP_002262237
UniProt: A0A1A7VH32 B3LCF6
LinkDB All DBs
Position
14:join(1494136..1494180,1494419..1494877,1495046..1495177,1495329..1495631,1495757..1495921)
Genome map
AA seq 367 aa AA seqDB search
MYKSLFDKLKEGPLKISILGSGNWASAISKVVGTNAKNNYLFENEVKMWVRDERVNGESI
VDIINKKHENVKYLKGVSLPHNIVAYSDLSKVINSADLLIFIIPSQYLENALKLIKENQS
INIGKHTRAISLTKGFIIKNNEMYLCSKYISNLLGIPCSALSGANIAMDVAMEEFSEATI
GGNENETLLIWQRVFDLPYFKINCVNETVGVEIFGALKNIITLAAGFCDGLNASTNSKSA
IIRIGVKESFLFGKTFFNYSDVSIFFESCGLADIITSFLSGRNAKCSAEFVKCKPKKTWE
QLESEILKGQKLQGIVTLKYVYQMIKKNDLTHEFPLFTILHKISFENGDPRELLNIFMNN
TVSGIAT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagagcctgttcgataagcttaaggaaggcccactaaagatatccatcctgggc
agcgggaactgggcgagcgcaatcagcaaagtcgtgggaacgaatgcaaagaataattat
ttatttgagaatgaagtgaaaatgtgggtacgagacgaacgggtaaatggagaaagtata
gtggatataattaacaagaagcatgaaaatgtaaaatacttaaagggggtgtccttaccg
cacaacattgttgcctattcagatttatccaaagtgattaattctgctgacctgttaata
tttataatcccatctcaatatttagaaaacgcattaaagttaataaaagaaaaccaatcc
attaatatagggaagcacacaagggctatttccttaactaaaggatttatcattaaaaat
aatgagatgtatctgtgctccaagtacattagcaaccttctgggaattccttgttctgcc
ttgtcgggtgcaaacatagccatggacgtagccatggaagaattctctgaagccactata
ggaggaaatgaaaatgaaacgcttctaatttggcaacgggtttttgacttgccctatttt
aaaataaactgcgttaatgaaactgtgggcgttgagattttcggtgcgttaaaaaatatc
ataacattagcagctggattttgcgacggactcaatgcttccaccaattccaaatcggcg
attatccgaattggagttaaggaatccttcctttttgggaaaacattttttaactattct
gatgtaagcatattttttgagagctgtggcttggctgatatcatcacatccttcctgagc
ggtaggaacgcaaagtgctctgcggagtttgtaaagtgtaagccaaagaagacgtgggaa
cagctggagagtgaaatcctcaaggggcagaaattgcagggaattgtgactttgaagtac
gtttaccaaatgatcaagaagaatgacttaacccacgaatttcctcttttcacgattctc
cacaaaatatcgtttgaaaatggggacccccgagaactgttgaacatatttatgaacaat
acagtttcgggaatagcgacgtag

DBGET integrated database retrieval system