KEGG   Pontibacter korlensis: PKOR_01750Help
Entry
PKOR_01750        CDS       T03841                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pko  Pontibacter korlensis
Pathway
pko00052  Galactose metabolism
pko00511  Other glycan degradation
pko00600  Sphingolipid metabolism
pko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PKOR_01750
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PKOR_01750
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PKOR_01750
Enzymes [BR:pko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PKOR_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 Big_1
Motif
Other DBs
NCBI-ProteinID: AKD02096
UniProt: A0A0E3UVR7
LinkDB All DBs
Position
complement(423004..425475)
Genome map
AA seq 823 aa AA seqDB search
MNKSIERVLTYSSKFALILIALVGAYACKSVLNTSEEEKMQVREKSDFNKGWSFHLGDQQ
NAQDPNFNSSQWRTLNLPHDWSIEGEFSEKHPAGTGGGALPGGIGWYRKAFTVDEADKGK
VFYIDFDGVYSNSEVWINGQSLGKRPNGYISFRYDLTPHLKYGNEQNVIAVKVDNAQQPN
SRWYSGSGIYRNVWLTKVNPVHVAHWGTYVTTPEVSEQSAKVTISTKVNNRGQQPGTYSL
TNIVYDTTGAEVARVTSEDVQLQSVENEINQELTVNNPKLWSVEDPYLYRVVTLVEQKGE
VVDNYETPLGIRYFNFDVEKGFTLNGKPMKILGVCNHHDLGALGAAINTRALERQLEIMK
GMGVNGIRTAHNPPAPELLELCDKMGFIVMDEVFDMWKKSKSKYDYSLAWDEWHEQDLKD
FIRRDRNHPSVFIWSIGNEIPEQWGLEGTPIAKELAGIVKSLDRTRPITAGLNEPYPHNS
IYQSGVLDLVGFNYHHQDFEKFPETFPGQKFIATETTSALATRGHYDMPSDSIRRWPYKW
DEPFTDGNKDLTVSAYDNVSTPWGSTHEETWKVMKKHDFLSGMFIWTGFDYLGEPTPYGW
PARSSYFGVVDLAGFPKDAYYMYKSEWTDEPVLHVFPHWNWEPGKTVDVWAYYNNADEVE
LFLNGKSLGTKKKEGNDLHVMWRIPYQPGTLKAVSRKGGQEVLTREVKTTGAPAKIVLEA
DRRNINADGKDLSFVTVKIVDKEGNVVPKADNLVRFNVEGNAFIAGVDNGLQTSMEPFKT
NQRAAFNGLALVILQAKEEAGEVKLTATSKGLESESVTITLKE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaattgaaagagttttaacctatagctctaagtttgcccttatacttata
gcccttgttggagcttatgcctgtaaatctgttctgaatacttccgaagaggaaaagatg
caggtgagagaaaaatctgattttaacaaaggctggtccttccatttaggtgaccagcag
aacgcgcaagacccaaatttcaatagctcgcagtggcgcacgcttaacctgccgcacgac
tggagcatagaaggagaatttagcgaaaagcatccggctggtacaggcggtggcgctttg
ccgggtggcattggctggtaccggaaagcctttacagttgatgaggcagacaaaggcaag
gtcttctacattgactttgatggggtatacagcaacagcgaagtatggattaacgggcag
agcctgggcaagcgcccgaatggttacatatcattccgttatgaccttacgccgcacctg
aagtatggaaacgaacaaaacgtaattgccgtgaaggtggacaacgcgcagcagccgaac
tcccgctggtactcaggttcaggcatctaccgtaatgtatggctcaccaaggtaaacccg
gtgcatgtggcgcattggggtacctacgtaaccactccagaggtaagcgagcagtcggct
aaagttaccatcagcaccaaagttaataaccgggggcagcagccaggtacatactcgctg
accaacattgtctacgacactacaggtgccgaggtagcccgtgtaacttcagaggatgta
cagctgcaaagcgttgaaaacgaaattaaccaggagcttactgtaaataacccgaagctc
tggtcggtggaggatccatacttatacagagtggtaacgctggtagagcaaaagggcgaa
gtagtagataactatgagacgcctttaggcattcgctacttcaactttgatgtggagaaa
ggcttcacgctgaacggcaagccaatgaagatactgggggtttgcaaccaccacgacctt
ggtgccttaggcgcagctatcaatacccgcgcattggagcgtcagctggaaataatgaaa
ggcatgggcgtgaatggcatccgcacagcgcataaccctcctgcccctgagttgctggag
ctgtgcgataaaatgggctttattgtgatggatgaggtgtttgacatgtggaagaagtct
aagagcaagtatgactacagccttgcgtgggatgagtggcatgagcaggacctgaaggat
tttatacgtcgtgaccgtaaccacccaagcgtatttatctggagcatcggcaatgagatt
ccagagcagtgggggctggaaggcacgccgatagccaaagagttagctggcattgtgaag
agcctggataggacgcgtccgataacggctggcttgaacgagccctacccgcacaactca
atttatcaatcgggtgtgcttgatctggtggggtttaactatcaccaccaggactttgag
aagtttccggagactttcccggggcaaaaatttattgctactgaaactacctctgccctt
gcaacacgagggcactacgatatgccatcagatagtatacgccgctggccctacaaatgg
gatgagccgtttaccgatggtaacaaagacctgactgtttcagcctatgataacgtgagt
acgccttggggttctacccatgaggaaacatggaaggtgatgaagaagcatgatttcctg
tcgggtatgttcatctggaccggcttcgattacctgggagagccaacgccttatggctgg
cctgcccgcagttcatactttggtgtggtagatctggcaggcttcccgaaagatgcttac
tacatgtacaagagtgagtggactgatgagccggtgctgcacgtgtttccgcactggaac
tgggagccaggcaaaacagtagatgtgtgggcttactacaataacgcggatgaggtggag
ctgttcctgaacgggaagtcactaggcacaaagaagaaagaaggaaatgacctgcatgta
atgtggcgtatcccttaccagccaggtaccctgaaagccgtgtccagaaaaggaggccag
gaggtgctgacgcgtgaggttaaaacaaccggagcaccagccaaaattgtgctggaggct
gaccgtcgtaacatcaacgcagatggcaaagatctttcttttgtaacagttaaaatcgta
gataaagaaggaaatgtagtgcctaaagctgacaatttagttagatttaacgtagaagga
aatgcatttatagctggtgtagataatggtctacaaaccagtatggagcctttcaaaaca
aatcaacgcgctgcgttcaatggtttagccctggtgattcttcaggccaaggaagaagca
ggtgaggtaaaactaactgcgacatccaaaggtcttgagtcggaatctgtaactataaca
ttgaaggagtaa

DBGET integrated database retrieval system