KEGG   Pontibacter korlensis: PKOR_02165Help
Entry
PKOR_02165        CDS       T03841                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pko  Pontibacter korlensis
Pathway
pko00061  Fatty acid biosynthesis
pko00780  Biotin metabolism
pko01100  Metabolic pathways
pko01130  Biosynthesis of antibiotics
pko01212  Fatty acid metabolism
Module
pko_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PKOR_02165
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PKOR_02165
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PKOR_02165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pko01004]
    PKOR_02165
Enzymes [BR:pko01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PKOR_02165
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PKOR_02165
Lipid biosynthesis proteins [BR:pko01004]
 Fatty acid synthase
  Component type
   PKOR_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AKD02155
UniProt: A0A0E3ZE90
LinkDB All DBs
Position
complement(531331..532146)
Genome map
AA seq 271 aa AA seqDB search
MAYNLLKGKKGIIFGALDEKSIAWKVAKIAKEEGAEFVLTNAPLAMRMGEINKLAEECNA
EVIPADATSVEDLENLFTKAQEVLGGKIDFVLHSIGMSPNIRKGKSYGDLNYDWFLKTLD
VSALSFHKVMQVAEKQDAINDWGSIVALSYIAAQRVFPDYTDMSQAKAVLESIARNYGYR
YGKAKNVRVNTISQSPTKTTAGTGVGGFDVFYDYADKMSPLGNASAEDCANYCITLFSDL
TRMVTMQNLMHDGGFSSMGISEDIINMIQPK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaatctgctaaaaggaaagaaaggaatcattttcggtgcgctggacgagaag
tcgatagcctggaaagttgccaaaatcgcgaaagaagaaggtgctgagtttgtactgaca
aacgcgccattggcaatgcgtatgggtgagatcaacaagctggcggaggagtgtaatgca
gaagtaatcccagctgatgctacctctgtagaagacctggagaacctttttacaaaagct
caggaagtattgggtggcaagatcgatttcgtgctgcactcaattggtatgagcccgaac
atccgtaaaggtaagtcttacggagaccttaactacgattggttcctgaagacgctggac
gtatcagctctgtctttccacaaagtgatgcaggttgctgaaaagcaggatgccatcaat
gactggggctctattgtggcgctttcttacattgctgcacaacgtgtattccctgattac
acagatatgtcacaggctaaggctgtgctggagtctattgcacgtaactatggctaccgc
tatggtaaagcgaagaatgtacgcgttaacacaatctcacagtctccaactaaaacaaca
gctggtactggtgtaggtggcttcgacgtgttctacgattacgcagacaagatgtcgcca
ctaggcaacgcatctgctgaggattgcgcaaactactgcatcaccctgttctcagacctt
acccgcatggtaacaatgcagaacctgatgcacgacggtggcttcagcagcatgggtatc
tctgaggacattatcaacatgatccagcctaagtaa

DBGET integrated database retrieval system