KEGG   Pontibacter korlensis: PKOR_04630Help
Entry
PKOR_04630        CDS       T03841                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pko  Pontibacter korlensis
Pathway
pko00473  D-Alanine metabolism
pko01100  Metabolic pathways
pko01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PKOR_04630
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PKOR_04630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pko01011]
    PKOR_04630
Enzymes [BR:pko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PKOR_04630
Peptidoglycan biosynthesis and degradation proteins [BR:pko01011]
 Precursor biosynthesis
  Racemase
   PKOR_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AKD02543
UniProt: A0A0E3ZCF8
LinkDB All DBs
Position
complement(1129407..1131863)
Genome map
AA seq 818 aa AA seqDB search
MLTFQQLQSITQGKEVQFVQSLPVVHLLTDSRKLSQPTGSVFFAIKGKYNDGHKYLPQLY
AKGVRQFVLEQGEPQELQQLYPEANILQVANSMQALQQLAAWHRAQFNVPVVGITGSNGK
TIVKEWLSALLSPDEMVVKSPRSYNSQLGVPLSVWQLQPNHTLGVFEAGISQPGEMEKLQ
AVIQPTIGIFTNVGSAHDEGFASREQKVQEKLKLFREVELLFYCADYELLHQQVQAQSIK
SFTWSRQQPEADLYISATTTAGHRTIVVYTFEGEKQRLTLPFTDEASVENALHCLAILLY
RRLPLSEIQERLDRLHPVAMRLEMKEAINGCYLIDDTYNNDLAGLAIALDLQASQPQRGR
HTIILSDVLESGLAEEELYRKVAELVQAHKVERLIGIGATISKYNQLFSESDFYTSTAEF
LKVFNPASFRNEVILVKGARVFEFEKIVQAFQQKVHGTVLEVNLDALVHNLNYYRSKLAP
DTKLMVMVKAFAYGSGSFEVANLLQFHRVDYLAVAYVDEGVALRENGITLPVMVMNPSPD
SFVKLRQYNLEPEIYALEQLEAFVGSLEPDAKYKIHLKLDTGMHRLGFEPEDFEELFRLL
EQYPQVQVASTFSHLAGADEAIHNDFSQLQIARFRSMAAELEERLGYKVIKHILNSAGIV
RFPEHQLDMVRLGIGLYGVEATGSEQEALRPVSTLKTTVSQVKSVRQGDTVGYSRKGIAS
TDRTTATIAIGYADGYDRRFSNGVGQVFINGHRCPIIGNVCMDMCMVDVTGVEVKAGDAV
TVFGIDLPLVELAQNIGTIPYELLTNVSTRVKRIFYSE
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgtttcagcagctccaaagtataactcagggtaaagaggtgcaatttgtacag
tcactgcctgtcgtgcacctccttaccgatagccgcaagctttcgcagccgacaggttcg
gtattttttgctatcaagggcaagtataatgatgggcacaagtacttgccacagctatat
gcaaaaggggtgaggcagtttgtgctggagcagggcgagccacaggagttacagcaactt
tatccggaggcaaacatcctacaggtggctaatagcatgcaggcattgcagcagctggcg
gcatggcaccgggcacagtttaatgttccggtggttggcatcacggggagcaatggcaaa
accattgtaaaagaatggctgtcggctttgcttagtccggatgaaatggtagtgaagagc
ccgcgtagctataattcgcaactgggtgtgccgctgagtgtatggcagctgcagcctaac
cacaccttgggtgtcttcgaggcgggcatatcgcagccgggggagatggagaagctacaa
gctgtcatccaaccaactattggcatctttaccaacgttggcagtgctcatgatgaaggc
tttgcctcccgggagcagaaggtacaggagaaactaaagctgttcagggaggttgagttg
ctgttttactgtgctgattatgaactgctgcatcaacaggtgcaggctcaaagtataaaa
tcctttacatggagccgtcagcagccggaagcagacctttacatcagtgctactaccacg
gcagggcacagaacaattgtggtctatacttttgaaggggaaaagcaacgcctgaccttg
cctttcactgatgaggcctctgttgaaaatgcgctacactgcctggctatacttttgtac
cgccgtctgccgctctccgaaattcaggaacgtcttgatcgcctgcacccggtggccatg
cgcctggagatgaaggaagccatcaacggctgttacctcatcgacgatacttacaacaac
gacctcgccggccttgccatcgcgcttgatctgcaggctagtcagccgcaacgggggcga
cacacgatcatactttcagacgtgctggagtcaggcttggcggaggaggagctgtaccga
aaggttgctgagctggtgcaggcgcacaaggtggagcgtttgatcggtatcggagctacc
attagcaagtataaccaacttttctcagagtccgatttttatacttccaccgcagagttt
ctcaaggttttcaatcccgcaagcttccgtaacgaggttatcctggtaaaaggcgcgaga
gtgtttgagtttgagaagattgtgcaggcttttcagcagaaggtgcacggtacggtgctg
gaggtaaacctggatgcgctggtgcataacctcaactattaccgctccaaactcgccccg
gataccaagcttatggtaatggtgaaagccttcgcctacggcagcggtagctttgaggta
gctaacctgttgcaattccacagggtagattacctggctgttgcttatgtagatgaaggc
gtagcattgcgcgagaacggcattacgctgccagttatggtaatgaacccttcgccagac
agcttcgtgaagttacggcagtataacctggagcctgaaatctatgctctggagcagttg
gaggcatttgttgggtcgctggaaccagacgcaaagtataaaatccacctgaaactggac
acgggcatgcaccggctaggctttgagcctgaggatttcgaggagttgttcaggctgctg
gagcagtacccacaggtgcaggttgccagcacctttagccacttagcaggggccgacgag
gccatccacaatgatttctcacagctgcagattgctaggttcagaagtatggcagccgaa
cttgaagagcgtttggggtacaaagtcattaagcatattctaaactcggcaggcattgtg
cgcttcccggagcaccagctggacatggtgcgcctgggcataggcctgtatggtgtagaa
gctacaggttctgagcaggaagcactgcggccggtaagtacactaaaaacaacggtgtcg
caggttaaaagtgttaggcaaggcgatacggtgggctacagccgcaaaggcattgccagc
actgaccgcaccaccgcaacaattgccattggctatgccgatggttatgaccgccgcttc
agcaatggggtagggcaggtttttatcaacgggcaccgctgccccatcatcggcaatgtg
tgtatggatatgtgcatggtagatgtaacaggcgtagaagtaaaagcaggcgacgcggta
actgtttttgggattgatctgcctctggtggagctggcgcaaaacatcggtactattcct
tatgagcttttaaccaatgttagcacacgcgttaagcggattttctattctgagtaa

DBGET integrated database retrieval system