KEGG   Pontibacter korlensis: PKOR_07120Help
Entry
PKOR_07120        CDS       T03841                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
pko  Pontibacter korlensis
Pathway
pko00380  Tryptophan metabolism
pko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    PKOR_07120
Enzymes [BR:pko01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     PKOR_07120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DUF4851 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AKD02937
UniProt: A0A0E3UVZ3
LinkDB All DBs
Position
complement(1675084..1676364)
Genome map
AA seq 426 aa AA seqDB search
MNYQNTLAFAQEQDRQDPLYYFRDRFYFPQVNGQDAIYFCGNSLGLQPKSAQMYIDNEMY
KWANLAVEGHFKGEEPWFNYHELLAAGAARVVGAKESEVVVMNQLTVNLHLMLVSFYRPQ
GKRFKIITEGGAFPSDQYALETQTKFHGYNPDEAIIELFPKEGEHTLRTEDILQSIKEHG
DELALVMMGGINYYTGQVFDMEAITKAGHEAGAFVGFDLAHAAGNVLLKLHDWDVDFAVW
CTYKYLNSGPGGTSGVFVHERFGNDTDLPRFAGWWGHDAGERFKMQKGFKPMPGAAGWQL
SNSQILPMAVHRASLQLFDEAGGMEVLRAKSEKLTGYLEYLINDVPVGKDVLEMITPQDP
QARGSQISLLVKQNSRLLFDKLMEAGIIVDYREPNVIRIAPTPLYNSFEEVYRFSEILHE
CLEGVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcaaaacacgcttgcctttgcacaggagcaagacaggcaagacccactatac
tacttcagagatcgcttttattttccgcaggtaaatggccaggatgcgatttacttctgt
ggtaactcgctaggcctgcagcctaagtcggcgcagatgtacatcgacaacgaaatgtat
aaatgggcaaacctggcggtagaaggacacttcaagggcgaagagccatggtttaattac
cacgagctattagcagcaggcgctgcccgtgtggtgggagctaaagagagcgaggtagtg
gtaatgaaccaactgaccgtgaacctgcacctgatgctggtgtctttttacaggccccag
ggcaagcgcttcaagatcataaccgaaggcggtgctttcccttcagaccagtatgctttg
gagacccagaccaagtttcatggatacaatcctgacgaggctatcatagagcttttccca
aaagagggcgagcacacactgcgcacggaagacatcctgcaaagtataaaggagcacggc
gatgagctggcgctggttatgatgggtggcataaattactacaccggccaggtattcgac
atggaagctattacgaaggcaggccatgaggcaggtgcttttgtaggctttgacctggcc
catgctgctggcaacgtactcctgaaactgcacgattgggacgttgactttgccgtgtgg
tgtacttataagtatcttaactccggcccgggtggtacgtcgggtgtgtttgtgcacgag
cgttttggcaacgatactgacttgccgcgttttgctggttggtggggccacgatgctggc
gagcgctttaaaatgcagaaaggctttaagcctatgccgggagcggcaggctggcagcta
agtaattctcaaatcctgccgatggctgtacaccgtgcttcgcttcagctgtttgatgag
gctggcggcatggaagtcctgcgcgccaaaagtgagaagctaacaggctacctggagtac
ctgatcaacgatgtacctgtaggcaaagatgtactggagatgatcaccccgcaagacccg
caggcccgtggtagccagatatcgctgctggtaaagcagaattcacgcctgctgttcgat
aagctgatggaggctggcattatagtagactaccgtgagcctaacgtgatccggatagcc
cctactccactatataatagcttcgaagaagtataccgcttttccgaaatcctgcacgag
tgcctggagggtgtaaagtag

DBGET integrated database retrieval system