KEGG   Pontibacter korlensis: PKOR_16690Help
Entry
PKOR_16690        CDS       T03841                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pko  Pontibacter korlensis
Pathway
pko00500  Starch and sucrose metabolism
pko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PKOR_16690
Enzymes [BR:pko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PKOR_16690
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PKOR_16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AKD04425
UniProt: A0A0E3ZFL8
LinkDB All DBs
Position
complement(3887648..3889297)
Genome map
AA seq 549 aa AA seqDB search
MIEELWYKNAVIYSLDLETFMDYNGDGVGDFEGLTRRLDYLHAMGVDTVWLAPFQPTPNK
DNGYDIKDYYGVDPRHGSSGNFVEFMHQANKRGIKVIIDLVVNHTSVDHPWFQNARTGKD
AKYHDWYIWSEERPEDWDEGMVFPGVQKSTWTYDKKAKAYYYHRFYNFQPDLNMANPEVR
EEICRIMGFWLELGVAGFRVDAVPFLLEVTTTGPKEDKLNFKYLRELRRFLQWRRGDAIF
LGEANVLPKDTKKYFGEEGEGIHLMFNFYVNQYMFYALATGDIEPLKEALEATRINFPTS
HWANFLRNHDELDLGRLTDEQRQKVFARFGPDENMQLYGRGIRRRLSTMLGNRQQSELAY
SLMFSLPGAPVIRYGDEIGMGDDLSLKERDAVRTPMQWTAEKHAGFSAADKLIHPVIDEG
PYSYQHVNVDSQRRTPDSLLNWMTTLVRLRHECTEIGWGDWEILETNNAQILCMYYSWQG
SSLLIFHNFAEKASEVILDLKDKQINKLIDLMRQEESVANGKGRHHITLDAYGYRWFRAE
GITHLMQKG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagagctttggtataaaaatgcagtaatttatagtcttgatctggaaaccttt
atggattacaacggagacggagtcggcgattttgaaggccttacccgccgccttgattac
ctgcatgccatgggtgtagacacggtttggcttgcccccttccaaccaacgccgaacaag
gataatggctacgacatcaaagattattacggtgtggatccacgccacggctccagcgga
aattttgtggagtttatgcaccaggctaacaaacgcggcatcaaagtgatcatcgatttg
gtagtaaaccatacttctgtagatcacccctggtttcagaacgctagaactggtaaagac
gcaaagtaccacgattggtatatctggtctgaagaaagacctgaagactgggatgaaggc
atggtgtttccgggagtgcagaaatctacctggacctacgacaaaaaagccaaggcctac
tattaccaccggttctacaattttcagcccgacctgaatatggctaaccctgaagttcga
gaagaaatttgccggatcatggggttctggttagagttaggtgtggcaggtttccgggta
gatgcggttccttttttactggaggtaacaactaccggtcctaaggaagacaaactcaac
tttaaatacctacgtgaacttcgacgctttttgcagtggcgccggggagatgctattttc
ttaggggaagctaacgtattgcctaaagacactaaaaagtactttggagaagagggcgaa
ggcatacacctgatgtttaacttctatgtaaaccagtacatgttttatgcactggccaca
ggagacatagagcctttgaaggaggctttagaagcaacacgtattaatttccctacctcc
cactgggctaatttcctgcgcaaccacgacgagctggacttggggcgcctaacagatgag
cagcggcagaaagtatttgcccgctttgggccagatgaaaacatgcagctctacggcagg
ggtatccggcgccgcttgtctaccatgctgggtaacaggcagcagagtgagctggcctac
agccttatgttctccctccctggagcacctgttatccgttatggagacgaaataggcatg
ggagatgacttgagcctgaaggagcgtgatgctgtaagaacaccaatgcagtggactgct
gaaaagcatgccggtttttcagcggcagacaagctaatacatcctgtaatcgacgaaggc
ccttactcctatcagcatgtaaacgtggacagccaacgccgtacccccgactccctgcta
aactggatgacaacactggtgcgcttgcgccacgaatgcaccgagatcggatggggagat
tgggagattttagaaaccaataacgcacaaatattgtgcatgtactacagctggcagggt
agttcgcttctcatctttcataacttcgcagagaaagccagtgaggttattctagacctg
aaggacaagcagataaataaactgatagacctgatgcgtcaagaggaaagtgtggctaac
ggtaaaggaaggcaccacattacactagatgcatacggctaccgctggttccgagctgaa
ggtataacccacctcatgcagaagggttaa

DBGET integrated database retrieval system