KEGG   Pontibacter korlensis: PKOR_17130Help
Entry
PKOR_17130        CDS       T03841                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pko  Pontibacter korlensis
Pathway
pko00061  Fatty acid biosynthesis
pko00620  Pyruvate metabolism
pko00640  Propanoate metabolism
pko01100  Metabolic pathways
pko01110  Biosynthesis of secondary metabolites
pko01120  Microbial metabolism in diverse environments
pko01130  Biosynthesis of antibiotics
pko01200  Carbon metabolism
pko01212  Fatty acid metabolism
Module
pko_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PKOR_17130
   00640 Propanoate metabolism
    PKOR_17130
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PKOR_17130
Enzymes [BR:pko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PKOR_17130
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PKOR_17130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AKD04499
UniProt: A0A0E3ZGZ9
LinkDB All DBs
Position
complement(3988437..3989783)
Genome map
AA seq 448 aa AA seqDB search
MFKKILIANRGEIALRIIRTCKEMGVKTVAVYSTADKESLHVRFADEAVCIGPPPSAQSY
LNIPNIIAAAEITNADAIHPGYGFLSENADFSRICAENGIKFIGATPEMINAMGDKASAK
DTMKKAGVPTIPGSEGLLKNMEEGIKLAKKIKYPVIIKATAGGGGRGMRIIKSEAEFEKA
WNDARTEAKAAFGNDGIYLEKFVEEPRHIEIQLIGDQHGQVAHLSERDCSIQRRHQKLVE
ETPSPFITDELRDAMGQAAIAGAKAINYEGVGTIEFLVDKNRDFYFMEMNTRIQVEHPIT
EEVIDYDLIKEQIKVAAGEKITGKNYYPKMHAIECRINAEDPKNGFRPSPGKITTLHLPG
GHGVRVDSHVYSGYVIPPNYDSMIAKLIVSAQTREEALVKMKRALSEFVIEGIKTTVPFH
LKLMDDKGFKEGDFTTKYLDDFDFNSID
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaatactcattgctaaccgtggcgaaatcgccctgcgcattatccgcact
tgtaaggagatgggcgttaagacggttgcagtatactctacagccgataaagaaagctta
cacgtgcgttttgccgatgaagctgtctgcattgggcctcctccgagtgctcagtcatac
ctgaacattcctaacattattgcggcagcagaaattaccaatgctgatgccattcaccct
ggctacggcttcctttctgagaacgctgatttttcacgcatctgtgcagagaacggcatt
aagtttattggcgcaactccggagatgatcaatgccatgggcgataaggcttcagccaaa
gacaccatgaaaaaagcaggtgtacctaccattcctggttctgaaggtttgctcaagaac
atggaagaaggtatcaagcttgctaaaaaaatcaaatacccggttatcatcaaggcaact
gctggtggtggtggtcgtggtatgcgaattatcaagagcgaagccgaattcgagaaggct
tggaacgatgcgcgtactgaggctaaagctgctttcggtaacgatggtatctaccttgag
aaatttgtagaggagccacgccacatcgagatccagcttatcggtgaccagcatggccag
gttgctcacttatcagagcgtgactgctctatccagcgccgccaccaaaaactggtagag
gaaactccttccccgttcataacagatgagcttcgtgatgcaatgggacaggctgctatt
gccggtgccaaagccatcaactacgaaggtgttggtactatcgagttcctggtagacaag
aaccgtgacttctacttcatggagatgaatactcgtatccaggtagagcacccaattaca
gaggaggtaatcgactacgacctgatcaaggagcaaattaaggtagctgctggtgagaaa
atcactggtaagaactactaccctaagatgcacgctattgagtgccgcatcaacgctgag
gacccgaagaacggcttccgtccaagcccagggaaaatcactaccctgcacctgccaggt
ggccatggcgtacgtgtagactcacacgtatactctggctatgtaatcccaccaaactac
gactctatgatcgcgaagctgatcgtgagtgcgcagacacgtgaggaagcccttgtgaag
atgaagcgtgctctgagtgagttcgtaatcgaaggcatcaagaccaccgttcctttccac
cttaagttgatggatgacaaaggctttaaggagggggacttcaccaccaaatatctggat
gactttgacttcaactctattgactaa

DBGET integrated database retrieval system