KEGG   Pontibacter korlensis: PKOR_17270Help
Entry
PKOR_17270        CDS       T03841                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
pko  Pontibacter korlensis
Pathway
pko00380  Tryptophan metabolism
pko00630  Glyoxylate and dicarboxylate metabolism
pko01110  Biosynthesis of secondary metabolites
pko01130  Biosynthesis of antibiotics
pko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pko00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PKOR_17270 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PKOR_17270 (katE)
Enzymes [BR:pko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PKOR_17270 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AKD04526
UniProt: A0A0E3UYK3
LinkDB All DBs
Position
complement(4017748..4019958)
Genome map
AA seq 736 aa AA seqDB search
MKENENKDEKQFDPSRKVDQNTKNHQLASFREDPKDQYMTTDQGVRVNHTDDSLKAGSRG
PTIMEDFHFREKMTHLDHESIPERVVHARGSGAHGYFQPYNDSMKEYTKAKFLTDPNSKT
PVFVRFSTVVGSRGSADTVRDVRGFATKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHA
IKPDPDNEIPQASAAHDTFWDFASLMPETNHMLMWVLSDRAIPRSFRMMDGFGVHTFRFI
NEAGKSRFVKLHWRSLLGAHSLMWDEAQKLGGKDSDWLRRDLWDAIEKGDYPEFELSVQI
VEEEDEFKFDFDLLDPTKIIPEELVPLQPIGKMVLNRNPDNFFAETEQVAFHPGNLVPGI
DVTNDPLLQGRLFSYIDTQLNRFHSSNFGELPINRPVCPVHNQQGAGFMRQTINKGKVNY
WPNSLGGGCPMMAPENMNGYVHHMEMVEGHKVRARSASFNDHYSQATMFWNSMTEPEKKH
IIAAAHFELGKVQSKEVRECMVGQFHKIAPEFGKSVAEGVGVEVPTNFEQELTGNYKDNE
ASKMMKKGKSVKESPSVSMERNKIETVKTRQVAILLEDGFDCNELVQVRQALMDAGAQVK
IVSKFLGMRKASNGEEVKVDKSHITTASIMYDALYIPDGKASIEILMKEGDALHFINEAF
KHCKTIATSGDGIRLLEKSGIVGVRYADKTSQSVKDDTGVITAGNDADADEFAEMFMAAI
KKHRHWNREERMMVPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacgaaaacaaggacgaaaagcagttcgatccttcacgcaaagttgaccag
aacacgaagaaccaccagctagcatcttttagggaagacccgaaggaccagtacatgacc
actgatcaaggtgtaagggttaaccacaccgatgactccctcaaagcaggctcacgtggg
ccaactattatggaagactttcacttcagggaaaaaatgacacacctggaccatgagtct
attccggaacgtgtggttcatgccagaggctcaggggcacatggctactttcagccatac
aatgactccatgaaagagtataccaaggcaaaatttctgacagaccctaattctaaaacc
cctgtgtttgtaagattttctactgttgtgggctccaggggttctgcggacacagtgcga
gatgtacgaggatttgctacaaagttctatactgaagagggcaactacgacttagtaggc
aataatattccggtattctttatccaggatgccatcaaatttcccgacttagtacatgcc
atcaagccagatcctgacaacgaaataccacaagcctcagccgcacatgacactttctgg
gactttgcttcgctgatgccagagacaaaccacatgctgatgtgggtgttatctgacaga
gctataccacgaagcttccggatgatggatggttttggagtacacaccttccgttttata
aatgaagccggcaagtcacgttttgtaaaactccactggcgctcgctgctgggagcacat
tccttgatgtgggatgaggcacagaagctaggtggcaaagactccgattggttaagacga
gatctatgggatgccattgagaaaggtgattatccagagtttgagttaagtgttcagatt
gtggaagaagaagacgagtttaagtttgattttgacttactggaccctaccaagattatt
ccggaagagctggtgccactgcagccaattggcaagatggtgctgaaccgcaaccctgat
aatttctttgcagaaacagaacaagtagccttccaccccggaaacctggtgccaggcata
gatgtaacaaacgaccctctgctgcagggtcgcctcttctcctatatcgacacccagcta
aaccgtttccatagctctaattttggtgaactgccaataaacaggccagtatgtccggta
cacaaccaacagggagcaggttttatgcggcaaaccatcaacaaaggcaaagtaaattac
tggcctaactccctcggaggtggctgccctatgatggcaccagaaaacatgaatgggtat
gtacatcatatggagatggtagagggccataaagttcgcgcccgaagtgcaagcttcaat
gatcattatagccaggccacgatgttttggaactccatgacggaaccagagaaaaagcat
atcatagccgccgctcattttgaattaggcaaagtacagtctaaagaagtgcgggagtgt
atggtaggccaattccataagatagcaccagagttcggtaaaagcgtagccgagggagta
ggcgtagaagtgccgacaaactttgaacaagagttgaccgggaactacaaagacaatgag
gcttctaaaatgatgaaaaaagggaaatcggttaaagaatccccgtcagttagtatggaa
cgcaacaagatcgaaaccgttaagacgagacaagttgctatactgctagaggatgggttt
gactgtaacgagttggttcaggtaaggcaggcgctaatggatgcgggggcacaagttaaa
attgtttcaaagtttctggggatgcgcaaggccagcaatggtgaagaggtaaaagtagat
aaaagccatatcacaacagcctctatcatgtatgacgcactctacataccggatggcaaa
gcaagtatagaaattcttatgaaagaaggcgatgcgctgcatttcataaatgaagccttt
aagcactgcaaaactatagccacttcaggtgatggaattaggctgctagaaaaatctggc
attgtcggagtgcgttatgccgacaaaacatcgcaatctgttaaggatgatacaggtgta
ataactgctggtaatgatgctgatgccgatgagtttgccgaaatgtttatggcagccatc
aagaaacatcgccactggaaccgagaggaaagaatgatggtaccagcctaa

DBGET integrated database retrieval system