KEGG   Pontibacter korlensis: PKOR_21100Help
Entry
PKOR_21100        CDS       T03841                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pko  Pontibacter korlensis
Pathway
pko00010  Glycolysis / Gluconeogenesis
pko00020  Citrate cycle (TCA cycle)
pko00620  Pyruvate metabolism
pko01100  Metabolic pathways
pko01110  Biosynthesis of secondary metabolites
pko01120  Microbial metabolism in diverse environments
pko01130  Biosynthesis of antibiotics
pko01200  Carbon metabolism
Module
pko_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PKOR_21100
   00020 Citrate cycle (TCA cycle)
    PKOR_21100
   00620 Pyruvate metabolism
    PKOR_21100
Enzymes [BR:pko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PKOR_21100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 QRPTase_N GCV_H PYNP_C HlyD_2 gerPA
Motif
Other DBs
NCBI-ProteinID: AKD05113
UniProt: A0A0E3ZGT6
LinkDB All DBs
Position
complement(4923844..4925535)
Genome map
AA seq 563 aa AA seqDB search
MAEVIRMPKMSDTMTEGVIASWLKKEGDKVSSGDILAEVETDKATMELESYEDGTLLYIG
PKKGDAVPVDAVIAIIGKEGEDISGLLNEVKGGGAPAAAKEEKQEEKKTETKPAAAAEEA
PANPGVDVSNIKASVIRMPKMSDTMTEGVLVSWQKKEGDKVKSGDILAEVETDKATMELE
SYEDGTLLYIGVKEGDSVAVDAIIAIIGEEGADYKALLNAASSNREDREENAKTDEAVQA
GVDAATSDKVQETEVPGPGAVEQGAADTSENGRIKASPLAKRVAKEKGYSLSQIKGTGEG
GRIVLRDVESFTPSAAPQKAAAPQTTAAPSAIPGAPGESYEEVNVSQMRKVIARRLAESK
FSAPHFYLTMEIDMDKAMEARASINEVSPVKISFNDLVIKAAAAALRQHPAVNSSWLGDK
IRYNKHINIGVAVAVEEGLLVPVVRNADYKSLSAISAEVKELGGKAKNKKLQPSEWEGNT
FTISNLGMFGIEEFTAIINPPDACIMAVGGIKQVPVVKNGNIQIGNVMKVTLSCDHRVVD
GAVGSAFLQTFKNLLENPVRILV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagttataagaatgcccaagatgagcgacacgatgacggagggggtgattgca
tcttggttgaaaaaagaaggcgataaggtgagctccggcgacatcctggccgaagtagag
accgataaggctactatggagctggaatcctatgaagatggtacactgctgtacatcggc
cctaaaaagggtgatgctgtgccggtagacgctgtaatagcgattattggtaaagaaggc
gaggatatttcaggcctgctgaacgaggtgaaaggtggcggcgcaccagctgctgctaaa
gaagagaagcaggaagagaaaaagactgaaaccaagccagccgctgctgcagaggaagcg
ccggcaaaccctggagttgatgtaagcaatatcaaggcttctgttatccgcatgccgaaa
atgagcgacaccatgactgaaggtgtacttgttagctggcagaaaaaagaaggtgataaa
gtgaagtctggtgacatcctggccgaggtagaaactgataaagctaccatggagctggag
tcttacgaagacggaacgctactatacattggtgttaaagaaggtgattctgtagctgtt
gatgccatcattgccattattggtgaagagggtgcagactacaaggcgcttctgaacgct
gcttcttctaacagagaagatcgtgaagagaacgctaaaactgacgaggctgtacaggct
ggagtagatgctgccacttctgataaagtacaggagactgaagtacctggaccaggagct
gttgagcaaggtgctgccgatacttctgagaatggccgtatcaaggcttctcctttggcg
aagcgtgttgctaaggaaaaaggctatagtttatctcaaataaaaggaaccggagagggt
ggccgtatcgtgctgcgcgatgtggagagctttacgccatccgctgcgccacaaaaagct
gctgctcctcaaactacagctgcgccttcagctatacctggtgcaccgggcgagtcttac
gaggaagtgaatgtatcgcagatgcgcaaggtaattgcacgtcgtcttgctgaaagcaag
ttttctgcgccgcacttctacctgaccatggagatcgatatggacaaagccatggaggca
cgtgccagcatcaacgaggtttctccggtgaagatatcgttcaacgacctggtgatcaaa
gctgcagctgctgcacttcgtcagcaccctgcagttaactcatcctggttaggcgataag
attcgttacaacaagcacatcaatattggtgtagcagtagcggtagaagaaggcctgttg
gtaccagtggttcgcaatgctgactataagtcgctttctgctatctctgcagaggtgaaa
gagcttggtggcaaagcgaagaacaagaagcttcagccttcagagtgggaaggaaatacc
ttcaccatctctaacctgggtatgttcggtatcgaggagttcacagccatcatcaaccca
ccagatgcttgcatcatggccgttggtggcattaagcaagtgccggttgtgaaaaatggt
aacatccagatcggaaacgtgatgaaagttaccttgtcttgcgaccaccgcgtagttgac
ggtgctgtgggatctgccttcctgcagacgttcaagaacctgttggaaaacccggtaaga
atcctggtgtaa

DBGET integrated database retrieval system