KEGG   Pseudomonas koreensis: AYO71_06980Help
Entry
AYO71_06980       CDS       T04647                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pkr  Pseudomonas koreensis
Pathway
pkr00970  Aminoacyl-tRNA biosynthesis
pkr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AYO71_06980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pkr03029]
    AYO71_06980
Enzymes [BR:pkr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AYO71_06980
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AYO71_06980
Mitochondrial biogenesis [BR:pkr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AYO71_06980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMT87290
UniProt: A0A142N7W3
LinkDB All DBs
Position
complement(1611843..1613294)
Genome map
AA seq 483 aa AA seqDB search
MHQMTLAEIARGLADKKFSSEELTKVLLARITQLDPQLNSFISLTEDLAIEQAKAADARR
ANGESGALLGAPIAHKDLFCTLGIRTSCGSKMLDNFKAPYDATVVAKLAAAGAVTLGKTN
MDEFAMGSANESSWYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPAATATDTGGSIRQPA
AFTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCAILLQGMAGFDPNDSTSIDE
PVPDYSASLGDSLQGLRIGVPKEYFSAGLDPRIAELIQNSIQQLQKLGAVIKEISLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGHRCENPENLIDLYKRSRGEGFGAEVQRRIMVGA
YALSAGYYDAYYLKAQKIRRLVKNDFMAAFNEVDIILGPTTPNPAWKLGAKNSDPVAAYL
EDVYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQLNTDWHTRTP
TGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaatgactctggccgagatcgcccgcggtctcgccgataaaaagttttcttcc
gaagagctgaccaaagtcctgctggcgcgtattacccagctcgacccacagctcaacagt
ttcatcagcctcaccgaggatctggccatcgagcaggcgaaagccgccgatgcacgccgg
gccaacggtgagagcggcgccctgctcggcgcgccgatcgcccacaaggacctgttctgc
accctgggcatccgcaccagctgcggctcgaagatgctcgacaacttcaaagctccgtat
gacgccaccgtagtcgcgaaactggcagctgccggcgccgtgaccctgggcaagaccaac
atggacgaattcgccatgggttcggccaacgagtcgagctggtacggcgcggtgaaaaac
ccgtggaacctggaacatgtgccgggcggttcgtccggtggctcggctgcggcagtagct
gctcgtctgttgccagcggccacggccactgacaccggcggctcgatccgtcagccggcg
gcgttcaccaacctcaccggcctgaagccgacctacggtcgcgtttcgcgctggggcatg
attgcctacgcttccagcctcgatcagggcggcccgttggcacgcacggccgaagactgc
gcgattctgctgcaaggcatggccggcttcgacccgaacgactccaccagcatcgatgag
ccggttccggattactccgccagcctgggcgattcgctgcaaggcctgcgcatcggcgtg
ccgaaggaatacttcagcgccggtctagacccgcgcattgccgagctgatccagaacagc
atccagcagttgcagaagctcggtgcggtgatcaaggaaatcagcctgccgaacatgcag
cacgccattcctgcgtactacgtgatcgccccggcagaagcgtcttccaacctgtcgcgt
ttcgacggcgtgcgtttcggccaccgctgcgaaaacccggaaaacctcatcgacctgtac
aagcgctcccgtggcgaaggcttcggcgcggaagtacagcgccggatcatggtcggtgcc
tacgcgctgtccgccggttactacgacgcctactacctgaaagcgcagaagatccgtcgt
ctggtgaagaacgatttcatggctgcgttcaatgaagtcgacatcatcctcggcccgacc
acgccgaacccggcctggaagcttggcgcgaagaacagcgacccggtcgcagcctatctg
gaagacgtctacaccatcaccgccaacctcgccggcctgccgggcctgtcgatgccggcc
ggttttgtcgacggtctgccggtgggcgtgcagttgctcgcgccgtacttccaggaaggc
cgcctgttgaacgttgcccaccagtatcagctcaacactgactggcacacccgcacccca
accggcttctga

DBGET integrated database retrieval system