KEGG   Pseudomonas koreensis: AYO71_16415Help
Entry
AYO71_16415       CDS       T04647                                 

Definition
(GenBank) MFS transporter
Organism
pkr  Pseudomonas koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_3
Motif
Other DBs
NCBI-ProteinID: AMT89047
UniProt: A0A142NBA1
LinkDB All DBs
Position
complement(3663399..3664577)
Genome map
AA seq 392 aa AA seqDB search
MAIYSPFIRRLMISSLTVVISRALVSPLLTLFLSNKLGLNPQDVGLLLGIAVFSATLLSL
YGGYIIDKLDKRQLLILAMLSSGIGLILLTFAQNLYVVTLVLIISETASALFLIGSKAIL
SEQLPVGQRVKAFSLNYTLTNIGYAVGPMIGVVIAGVQPSAPFIVAGAIAIGSIFLLLGA
TRDASPITSGSAPQSFLNTLMILKNDRTMVLFTLGCLLSTLVHGRFTLYLSQYLLVTHTQ
QQTLDTMAALLACNAITVILLQYQVGRWLSREHLRHWIAGGTALFIVGLIGFSVADSLLG
WCVAMFIFTLGEMIIYPADFLFVDTLAPEALRGSYYGAQNLSALGGAASPVMCGFLLMHT
PAPSMFYALSGLAALGGYLCFVSARRTASMQK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggccatctattcgccgttcatccgccggttgatgatcagctcgctgaccgtggtcatc
agccgcgccctggtcagcccgttgctgacactgttcctcagcaacaagcttggcctcaat
ccgcaggatgtcggcttgctgctcggcatcgccgtgttcagcgcaacattgctgtcgctg
tacggtggctacatcatcgacaagctggacaagcggcagttgctgatcctggccatgctc
tccagcggtatcggcctgattctgctgaccttcgcgcagaatctgtatgtggtcaccctg
gtgctgatcatcagcgaaaccgcgtcggctctgttcctgatcggctccaaggcgatcctc
agtgaacagctgccggtgggccagcgggtcaaggcgttttccctcaattacacgctgacc
aatatcggctatgccgtcggcccgatgattggcgtggtgattgccggggtgcagccgtcc
gcgccgttcatcgttgccggtgcgatcgccattggcagtatttttctgctgctcggcgcg
accagggatgccagtccgataacttccggcagtgcgccgcaaagtttcctcaacacgctg
atgatcctgaaaaacgaccgcaccatggtgctgttcaccctcggttgcctgctgagcaca
ttggtgcacgggcgctttacgctgtacctgtcgcaatacctgctggtcacccacacccag
caacagacgctcgacaccatggccgccctgctcgcctgcaacgcaatcacagtgatcctg
ctgcaataccaggtcggtcgctggctcagtcgcgaacacctgcgtcactggatcgccggc
ggtaccgcgctgttcatcgtcgggttgatcggtttcagtgtggcggacagcctgctcggc
tggtgcgtggcgatgttcatcttcaccctgggcgagatgatcatctaccccgccgacttc
ctgttcgttgacaccctcgccccggaggcactgcgcggcagttactacggcgcgcagaac
ctgtcagcgcttggcggggctgccagcccggtaatgtgcggatttctattgatgcacacg
cctgcgccaagcatgttctacgccctgagcggcttggcggcgctgggcggttatctgtgc
ttcgtcagcgcgcggcgcaccgcttcaatgcaaaaatag

DBGET integrated database retrieval system