KEGG   Pseudomonas koreensis: AYO71_17650Help
Entry
AYO71_17650       CDS       T04647                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pkr  Pseudomonas koreensis
Brite
KEGG Orthology (KO) [BR:pkr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYO71_17650
Enzymes [BR:pkr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AYO71_17650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored AlaDh_PNT_C Thi4 NAD_binding_7 K_oxygenase FAD_binding_3 Glutaredoxin NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AMT89267
UniProt: A0A142NBX1
LinkDB All DBs
Position
complement(3971038..3972600)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSREMLELLKDVASLSSQITLIDSGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIDQIRSLKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRKIMAVPSIYLNGENF
GQGRMGLEEILAKLDTGAIERQAEKISAKEAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRADKLIPGKNGEL
HEVHFASGATLKAKSVILATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGNGE
KVNGLRYKDRTTDELRTVELEGIFVQIGLLPNTDWLKGTIELSPRGEIIVDNRGETSIAG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcgtacctggaacgggtcacccaaccg
atcgagatcgttgcatccctcgacgacggtgcgaaatcccgtgaaatgctggaactgctg
aaagacgttgccagtctttcgagccagattactctgatcgacagcggtgacgatgcccgc
aagccatcgttctcgatcaatcgccctggagccgatatcagcctgcgcttcgccggtatt
ccgatgggccacgaattcacctcgctggtgttggctctgctgcaagtcggtggccatccg
tcgaaggccagcgttgaggtgatcgatcagatccgctcgctcaaaggcgagttcagcttc
gagacttacttctcgctgtcttgccagaattgcccggacgtcgttcaggcgctgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggcgcgctgttccaggac
gaagtcaacgatcgcaagatcatggctgtgccgagcatctacctcaacggcgagaacttc
ggccagggccgcatgggcctggaggaaattctcgccaaactcgacaccggcgcgattgag
cgtcaggccgagaagatcagcgccaaagaagcttttgacgtgctggtcgtcggcggtggc
ccggcgggtgcttcggccgctatctacgccgcacgtaaaggcatccgcaccggtgtcgcg
gctgagcgcttcggcggtcaggtgctggataccatggccatcgagaacttcatttccgtg
caggaaaccgaagggccaaaactggccacggcgctggaagaacacgtcaagcagtacgac
gtcgacatcatgaacctgcaacgcgctgacaagctgatcccgggcaagaacggcgagctg
catgaagtccacttcgccagcggtgcaaccctgaaagccaagagcgtgattctcgcgacc
ggcgcacgctggcgcgaaatgaacgtcccgggcgagcaggaataccgcaacaaaggcgtg
gcgtactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtagcagtgatcggc
ggcggtaactccggcgttgaagcggcgatcgatctggccggtattgtggcgcacgtaacg
ctgctggaattcgacgtgcaactgcgcgccgacgccgtgctgcaacgcaagctgcacagc
ctgccgaacgttaccgtgatcaccagtgcgcaaaccactgaagtcaccggcaatggcgag
aaggtcaacggcctgcgctacaaggaccgcactaccgatgaactgcgcacggttgagctg
gaaggcatcttcgtgcagatcggtctgctgccgaacaccgattggctgaagggcaccatc
gagctgtcgccgcgtggcgagatcattgtcgacaaccgtggcgagacttccattgcggga
atctttgcagcgggtgacgtgacgactgtgccgtacaagcagatcgtgattgcagtgggc
gagggcgccaaggcttcgctgagtgcgttcgatcacttgatccggacttcggcgccggcg
taa

DBGET integrated database retrieval system