KEGG   Pseudomonas koreensis: AYO71_18195Help
Entry
AYO71_18195       CDS       T04647                                 

Definition
(GenBank) NUDIX hydrolase
Organism
pkr  Pseudomonas koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX Nudix_N_2 NUDIX_4 Lar_restr_allev
Motif
Other DBs
NCBI-ProteinID: AMT89369
UniProt: A0A142NE03
LinkDB All DBs
Position
4098121..4098684
Genome map
AA seq 187 aa AA seqDB search
MFSPSFCPKCGGPDLGQQTPPGDTHERLMCRGCGYIHYVNPKIIAGCIIEQDGKYLLCQR
AIPPRPGTWTLPAGFMESGETTEQAALREVWEESGVRAEIVSPYSIFSVPKISEVYIIFR
AIALEITGQFGPETMDYKFFAPEEIPWEQIYYPAIRQILERYIEERQAGVYGIYVGNDDS
GKIHFMR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcccgagcttttgcccgaaatgcggtggccctgaccttggtcagcagacgccg
ccgggcgatacgcacgagcgcctgatgtgccgcggctgcggctatatccactacgtcaat
ccgaagatcattgccggctgcattattgagcaggacggcaaatacctcttgtgccaacgg
gcgatccccccgcgcccgggcacctggacgctgccggccggtttcatggaaagcggcgaa
accaccgagcaggcggcgctgcgcgaagtctgggaagaaagcggcgtgcgcgcggaaatc
gtctcgccgtattcgattttcagcgtgccgaagatcagcgaggtgtacatcatcttccgc
gccatcgccctggagatcaccgggcagtttgggccggaaaccatggattacaagttcttc
gcccctgaagagattccgtgggagcagatctattacccagcgatccggcagattctcgag
cgctatatcgaagagcgccaggctggggtttacgggatttacgtgggcaatgatgacagc
ggcaaaatccatttcatgcgctga

DBGET integrated database retrieval system