KEGG   Pseudomonas koreensis: AYO71_20205Help
Entry
AYO71_20205       CDS       T04647                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pkr  Pseudomonas koreensis
Pathway
pkr00010  Glycolysis / Gluconeogenesis
pkr00052  Galactose metabolism
pkr01100  Metabolic pathways
pkr01110  Biosynthesis of secondary metabolites
pkr01120  Microbial metabolism in diverse environments
pkr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYO71_20205
   00052 Galactose metabolism
    AYO71_20205
Enzymes [BR:pkr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AYO71_20205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Peptidase_S78_2
Motif
Other DBs
NCBI-ProteinID: AMT89749
UniProt: A0A142NF20
LinkDB All DBs
Position
4548837..4549985
Genome map
AA seq 382 aa AA seqDB search
MLQSRHLLSGLGLSLMIATLSANAAGLTAEHKAFGKTNDGTPVEQYILRNSHGMQATVIT
YGATLQALKVADKHGKFDDVVLGFDDVQGYQKGTAYFGATIGRFGNRLAEGAFELDGKRY
QVPQNDKSNALHGGPEGFDKKVWKAKETKDKDSVGVTLTYLSADGEMGFPGNLTTEVTYR
LTDNNELRIDYKASTDKPTVLNLTNHSYFNLAGAGNGDILKQVVMINSSHYTPVTAKLIP
TGELAPVTGTPMDFSKPTAIGTHIKADHPQLKFAEPKQGGFDFNWALDTKGDVSKLATEV
SDPQSGRVLQLFTSEPGVQFYTSNFLDGTVKGKGGKVYPHWGAFTLETQHYPDSPNQPDF
PSTRLDPGQTYAHSVILKFSTK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaatcccgtcacctgctctccggcctcggactgtccctgatgatcgctaccctt
tccgccaacgcggcgggcctgactgccgaacacaaagccttcggcaaaaccaatgacggc
acgcctgtcgaacagtacatcctgcgcaacagccacggcatgcaggccaccgtcatcacc
tacggcgcaaccctgcaagcgctgaaagtcgccgacaagcacggcaagttcgacgacgtc
gtcttgggctttgacgatgtgcagggctatcagaaaggcaccgcgtacttcggcgcgacc
atcggccgcttcggcaatcgcctggccgaaggtgctttcgaactcgacggcaagcgttat
caagtgccgcagaacgacaaatccaacgccctgcacggcggccctgaaggtttcgacaag
aaagtctggaaggccaaagagaccaaggacaaggattcggtgggcgtaaccctgacctac
ctgtcggcagacggcgagatgggcttcccgggcaatctgaccaccgaagtcacctatcgc
ctgaccgacaacaacgagctgcgcatcgactacaaggccagcaccgacaagccgaccgtg
ctcaacctgaccaaccatagctacttcaacctggccggcgccggtaatggcgatattctc
aagcaagtcgtcatgatcaactccagccattacacgccggtcaccgcgaaactgatcccg
accggggagctggcgcctgtcaccggtacgccgatggacttcagcaaaccgacggcaatc
ggcacgcacatcaaggctgatcatccgcagctgaagttcgccgagccgaaacagggcggc
ttcgatttcaactgggcgctggacaccaagggcgatgtcagcaagctcgccaccgaagtc
agcgacccgcaatccggacgggtcctgcaactgttcaccagcgagccgggcgtgcagttc
tacaccagcaacttcctcgacggtacggtcaagggcaagggcggcaaggtctatccacac
tggggcgcgttcaccctcgagacccagcactacccggattcgccgaaccagccagacttc
ccgagcacgcggcttgatccggggcagacttacgcccacagcgtgatcctcaagttctcc
accaagtaa

DBGET integrated database retrieval system