KEGG   Pseudomonas koreensis: AYO71_21515Help
Entry
AYO71_21515       CDS       T04647                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
pkr  Pseudomonas koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AMT89994
UniProt: A0A142NCJ0
LinkDB All DBs
Position
complement(4809082..4822080)
Genome map
AA seq 4332 aa AA seqDB search
MTDAFELPSTLVHALKRRAVLTPDRLALRFLAENPEQTVVLSYRELDQRARTIAAALQAE
AGFGERAVLLFPSGADYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLL
LTSADLRDALQQIEGAPPLLCVDTLDSALAEQWVEPPLPPEHIAFLQYTSGSTALPKGVQ
VSHGNLVANELLIRHGFGIDINPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCILMSPAY
FLGRPLRWLEAIAEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSEPIRLD
TLERFAEKFAACGFSDNSFMASYGLAEATLFVAGTPRGTGIPALRVDDQALAQNRAEPGD
GSAIMSCGISQPEHAVLIVEPNTLEELADNAVGEVWAAGPSIAHGYWRNPEASGKTFVQH
AGRTWLRTGDLGFIRDGELFVTGRLKDMLIVRGHNLYPQDIEQTVEREVEVVRKGRVAAF
AVNHSGEEGIGVAAEISRSVQKILPPDALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTS
SGKLQRSACRNRLADGSLDSYALFPSITAATETATSSTSDLEALIGQIWAEQLNVKQVSG
DDHFFLLGGNSIAATQVVARVREALGVELSLRLLFEAPTLSAFAAAVAQQQQTGGSAQGA
ISTLPRSEPMPQSLAQNRLWITWQLDPQSSAYNIPGGLRLRGELDVNAVRNSFQHLIERH
ESLRTRFFERDGVALQQVLADAEFNLQLIDISDLPIPEREARAEQIREDEARTRFDLEKG
PLLAVTLVRLDDEEHQLLVTLHHIIADGWSLNILLDEFSRLYAAATQGTPATLAALPTQY
ADYGNWQRQWLAQGEGERQLAYWKAQLGEEHPPLELATDHPRSARHNHSAARHSVRLSTE
LSEAIRQTAQAHQATPFMVLLAALHSLLHRYSGQRDIRIGVPNANRPRLDTQSLIGFFIN
TQVLRAQIDSRLTFAELLNQTRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQ
RDLSALKRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLAFDYASELFDATTIERLA
EHFHNLLSEVCEQPQQAIGDLRLLTASEQNQQKDWSVAPCTPAQQWLPELLEQQLRKTPQ
RTALVWDGGTLDFAELHAQSNRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGG
AYVPLDPDYPAERLAYMLRDSGVELLLTQTQLLERLPASDGVSVIAMDALHLDKWPSQAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQDTYRLDQADVLMQKAPISFD
VSVWECFWPLISGARLLLAAPGEHRDPHRIAQLVQQYGVTTLHFVPPLLALFIDEPLSAE
CTSLRRVFSGGEALPAELRNRVLTQLPAVQLHNRYGPTETAINVTHWHCSAADGERSPIG
RPLGNVICRILDADLNPVPAGVPGELCISGIGLARGYLGRPALTAERFVVDPLGEQGARL
YRTGDRARWSSDGVIEYLGRLDQQVKLRGFRVEPEEIQARLLAQNGVAQAVVLVRETAAG
AQLIGYFTATDAHENADEQIIRLKAALAAELPEYMVPAQLLRLDEMPLSPSGKLDRRALP
EPQWQVREHVEPVSELEQQIAAIWHEVLGLKQIGLRDDFFALGGHSLLATQIISRTRQAC
DVELPLRTLFEHSELGDYAEQIRLIQVSGRTNQQLPIAKIDRSQAVPLSYSQQRMWFLWQ
MEPDSPAYNVGGMARLRGVLHVEHFEAALQALILRHETLRTTFPSVDGVARQQVHAETGV
RMGWKDFSSLPAEVRELQVQQLADAEAHQPFNLETGPLLRACLVKTAEHEHYFVLTLHHI
VTEGWAMDIFARELSALYEAFVDERASPLEPLPVQYLDYSVWQRNWLESGERQRQLDYWT
AQLGREHPLLELPGDRPRPPVQSHQGELFRFDLSDDLAARVRAFNAQNGLTLFMTMTAAL
ATLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELFEQVRHT
VIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEYLANDA
RATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPTIARMARHWRNLLEALIADPQQRLSELP
LLDKSEQQQLLDSLGIEPGEHRLDQCIHHLFAEQALARKDAPALTFAGQTLSYAELDARA
NRLAWALRERGVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIED
SRVGLLLSDRAMFEALGELPPSVARWCLEDDSAGLADYPASELPFISLPQHQAYLIYTSG
STGKPKGVVVSHGEIAMHCQAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAQVV
LRAQGQWDAEEICGLIRAHRINVLGFTPSYGSQLAQFLATQNEVLPVRMIITGGEALTGE
HLQRIRAAFQPAQFFNAYGPTETVVMPLASLAPQVLEEGAGSVPIGSVIGARVAYILDAD
LALVPQGATGELFVGGAGLAQAYHDRPGISAERFVADPFAADGGRMYRTGDLVRQRADGL
VEYLGRIDHQVKIRGFRIELGEIETRLLDHPSIREAVVLALDAPSGKQLVGYLVTEVAER
NEVQQAELREALKSHLKAQLPDYMVPTHLLLLASMPLTANGKLDRRALPAPDLELNRQDY
VAPSNALEQTLAQIWCDVLNVRQVGLNDNFFELGGDSILSIQVVSRARQQGIHFSPRDLF
QHQTVQTLAAVASRTEQVMAEQGLVDGESRLTPIQHWFFDTDIPQRQHWNQALLLEPTAR
LEPQRLQQALQAVIEQHDALRLRFTETDDAWQATHQALTNEDVLWQVSVDSLDQCEALFA
DAQRSLHLHNGPLLRAVLVDVADVQQRLFIAIHHLVVDGVSWRVLLDDLQTAYRQLDAAQ
PLKLPAKTSAFKDWAARLQAYAGSESLREELGWWQTQLAGPSADLPCENPQGGRQNRHAQ
TVSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWSGQPSALIQLEGHGRETLF
DEIDLTRTVGWFTSAYPLRLTPHNVEEAAGQGASIKAIKEQLRAVPHKGLGYGVLRYLAD
DGCRQSMAALPQAPITFNYLGQFDQSFGSDALFRPLDEPIGAAHDPQAPLPNELSVDSQI
YGGELLLRWTFSAERYEAQTINDLADAYLGELQSLIAHCLQEGAGGLTPSDFPLARLTQA
QLDALPVPAAHIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPERFAQAWQ
AVVARHEALRASFCWNVGEDMLQVIHTPGRTPIEYLDWSAVAETEQEPKLQALLKSEREA
GFDLLNQAPFHLRLIKVGAARYWFMMSNHHILIDAWCRSLLMNDFFEIYTALGEGREAQL
SVPPRYRDYIGWLQRQSLAEARQWWRQNLQGFERTTPIPSDRPFLREHAGESGGMIVGDR
YTRLNVEDGARLRELAQAHQLTVNTFAQAAWALVLRRLSGDRDVLFGVTVAGRPVEMPEM
QRTVGLFINSIALRVKMPEDDQRSSVRQWLSALLDSNMQLREYEYLPLVNIQEQSELPKG
QPLFDSLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQR
YFDEATVERMLSEFKRLLLALVDGFHGDMADLPLLGDEERDFLLHGCNQSGHDYPLEQSY
VALFEAQVEAHPQRIAASCLDQQVSYAELNHNANRLGHALVAAGVRMDQPVALLAERNLD
LLGMIIGSFKAGAGYLPLDPGLPSQRLSRIIELSRTPLLVCSAACREQAQTLLEEFGCSN
RPRLLVWEEVQASAAATHNPGIHSGSDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKR
PYLDLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGLLAHVQAQGIT
VLESVPSLIQGMLGSERLSLDGLRWMLPTGEAMPPELAHQWLLRYPDIGLVNAYGPAECS
DDVAFFRVDMASTRGSYLPIGTPTDNNLLYLLDGALDLVPLGAVGELCVAGTGVGRGYVS
DPLRTAPVFVPNPFGAPGERLYRTGDLARRRADGVLEYVGRVDHQVKIRGYRIELGEIEA
RLHEQPEVRDAAVGVQEGVNGKHLVGYLVAADAALNPGERLERIKQRLRAELPEYMVPLH
WLWLEQMPLNANGKLDRKALPALEIGQLQSEDYLAPRNELEQTLADIWAEVLKVEKVGLR
DNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVEELAKYIDGLAASDITEEKVD
RLNDLMAELEGL
NT seq 12999 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgttcgaactccccagcaccctggtccatgccctcaagcgtcgcgcagtc
ctgacgccggaccgactggccttgcgttttctcgccgaaaacccggagcagaccgtggtg
ctcagctatcgcgaactggatcaacgcgcgcgcaccatcgccgctgcgttgcaggccgag
gccggattcggtgagcgtgcggtgttgctgtttcccagcggcgcggattacgtcgcggcg
tttttcggttgtttgtatgccggtgtgattgcggtgccggcctatccgccagaatccgcg
cgtcgtcatcatcaggagcgattgctgtcgatcatcgccgacgccgagcccaggctgttg
ctgaccagcgccgatctacgcgacgccttgcagcaaatcgaaggcgcgccgccgctgttg
tgcgtcgacactctggacagcgcactggccgaacagtgggttgagccgcccctgccgccc
gagcacatcgccttcctgcaatacacctccggctccaccgcgctgcccaagggcgtgcaa
gtcagccatggcaatctggtcgccaatgaactgctgatccgtcacggtttcggcatcgac
atcaacccggacgacgtcatcgtcagttggttgccgctgtatcacgacatgggtctgatc
ggcggtctgctgcaaccgattttcagcggcgtaccgtgcattctgatgtcgccggcgtac
ttcctcggccggccgttgcgctggctggaagcgattgccgaatacggcggcaccatcagc
ggcggcccggatttcgcctaccgtttgtgcagtgagcgggtcagcgagtcggcccttgag
cgcctcgatctgagtcgatggcgcgtggcctattccggttccgagccgatccgtctcgac
acccttgaacgcttcgcggaaaaattcgctgcttgcggtttcagcgacaacagcttcatg
gcttcgtacggtctggccgaggccaccctgtttgtcgctggcacaccgcgcggcaccggc
atcccggcgctgcgcgtggacgatcaggcgctggcgcaaaaccgcgccgagccgggcgac
ggcagcgcgatcatgagctgtggcatcagccagcctgagcacgcggtgctgatcgtcgaa
ccgaataccctcgaagaactcgccgacaacgccgtcggcgaagtctgggccgccggcccg
agcatcgcccacggttactggcgcaaccccgaagccagcggcaagacttttgtccagcac
gccgggcgcacatggttgcgcaccggcgacctgggttttatccgtgacggcgaactgttc
gtgaccgggcgcctgaaagacatgctcatcgtccgtggccataacctgtatccgcaggac
atcgagcagactgtcgagcgcgaagtcgaagtggtgcgcaaggggcgtgtggcggcgttc
gcggtcaatcacagcggcgaagagggcatcggcgtcgctgcagaaatcagccgcagcgtg
cagaaaatccttccgccagatgcgctgatcaaagccattcgccaagccgtggccgaggcg
tatcaggaggcgccaagcgtggtggtgctgctcaatccgggcgcgttgccgaaaacctcc
agtggcaaactgcagcgctcggcgtgccgcaatcgtctggctgatggcagcctcgacagt
tacgcgctgttcccttcgatcaccgcggcaacggaaaccgcgaccagcagcacttcggat
cttgaagcgttgatcgggcaaatctgggccgagcaactcaacgtcaagcaggtcagtggc
gacgatcacttctttctgctcggcggtaactcgatcgccgccacgcaagtggttgcgcgg
gttcgcgaagcactcggtgtcgagctgagcctgcgcctgctgttcgaagcgccaaccttg
tccgccttcgccgccgccgtggcgcagcagcaacagactggcggcagcgcccaaggtgca
atcagcacgttgccgcgcagcgagccgatgccgcagtcgctggcacaaaatcgtctgtgg
atcacttggcaactcgatccacagagcagcgcctacaacattcccggtggtctgcgcctg
cgtggcgaactcgacgtaaacgccgtgcgcaacagctttcagcatctgatcgaacgccac
gaatccttgcgcacgcgtttcttcgagcgcgacggcgtggcattgcagcaagtgctcgct
gatgccgaattcaacctgcaactgatcgacatcagcgacctgccaattcccgagcgtgaa
gcccgtgccgagcagattcgcgaagacgaggcgcgcactcggttcgatctggaaaaaggc
ccgttgctggcggtgacactggtgcgtctcgatgacgaagaacatcaactgctggtgacc
ctgcaccacatcatcgctgacggctggtcgctgaatattctcctcgacgaattctcgcgc
ctctacgcggcggcaacccaagggacgccggcgacactggcagcgctgcccacgcaatac
gccgattacggcaactggcagcggcaatggctggcgcaaggcgagggcgagcggcaactg
gcgtactggaaagcgcagttgggcgaagaacatccgccactggaactggccaccgatcac
ccgcgctcggccagacacaaccacagcgccgcgcgccacagcgtgcgcttgagtaccgaa
ctcagcgaggcgatccgccagactgcgcaggcccaccaggccacgccgttcatggtcctg
ctcgctgccttgcacagtttgctgcaccgctacagcggtcagcgcgacattcgcatcggc
gtgcccaacgccaaccgtccgcgcctggacacccaaagcctgatcggcttcttcatcaat
acccaggtgttgcgtgcgcagatcgattcacgcctgacatttgccgagttgctgaaccag
acgcgccaggccgcactcggcgcccaggcccatcaggatctgcccttcgaacaactgctc
gaagcgttcccgcaggcccgcgaacagggactgttccaggtcatgttcaaccatcagcag
cgcgacctcagtgcgctcaagcgcctgccgggtctgctcgccgaagaactgccgtggcac
agccgcgaagccaagttcgatctgcaattgcacagcgaagaggatcgcaacgggcgcctg
agcttggcgttcgactacgccagcgagctgttcgatgccacgaccatcgagcgtctggcc
gagcatttccataatctgctcagcgaggtctgcgaacagccacagcaggccatcggcgat
ctgcgcttgctgaccgccagcgagcagaatcaacagaaggactggagcgtcgctccgtgc
accccggcgcaacaatggctgccggaactgctcgagcaacaactgcgcaaaaccccgcaa
cgcaccgcgctggtgtgggacggcggtactctggatttcgccgagctgcacgcgcagtcc
aaccggctcgcccattacctgcgcgacaagggcgtcggccctgacgtgtgcgtggccatc
gccgccgagcgttcgccgcaactgttgatcggcctgctggcgatcatcaaggctggcggc
gcctatgtgccgctggatccggattatccggccgaacgacttgcatacatgctccgcgac
agcggcgtcgaactgctcctgacccaaacgcaattgctcgagcgtctgccggccagcgat
ggcgtcagcgtgatcgccatggatgcgctgcacttggataaatggccgagccaggcaccg
ggcctgcacctgcacggcgacaacctcgcctacgtgatttacacctcgggttccaccggg
caaccgaaaggcgtgggcaacacccacgccgcgctggccgagcgcctgcaatggatgcag
gacacttaccgtctcgaccaagccgatgtgctgatgcaaaaagcgccgatcagtttcgac
gtctcggtgtgggaatgcttctggccgctgatcagcggcgcgcgtctgctgcttgccgcc
cccggcgagcaccgcgacccgcatcgcatcgcgcaactggtccagcaatacggcgtgacc
acgctgcacttcgtgccgccgctgctggcgctgttcatcgacgagccgctgagtgccgag
tgcaccagcctgcgccgggtgttttccggcggtgaagctttgcccgccgagttgcgcaac
cgtgtgctgacgcaactgccggcggtgcagttacacaaccgctacggcccgaccgaaacc
gcgatcaacgtcacccattggcattgcagtgccgccgatggcgagcgctcgccgattggc
cggccgttgggcaatgtgatctgccgcatccttgatgccgatctcaatccagtgccggcg
ggcgtgccgggcgagctatgcatcagcggtattggtctggctcgcggttacctgggtcgt
ccagcgttgaccgccgagcgttttgtcgtcgatccactgggcgagcagggcgcccgtttg
taccgcaccggcgaccgtgcgcgctggtcctcggatggcgtgatcgaatatctcggccgt
ctcgatcagcaggtcaagctgcgcggctttcgcgttgagccggaagaaatccaggcacga
ctgctggcgcaaaatggcgtcgcccaggccgtcgtcctggtgcgggaaaccgctgccggt
gcgcaactgatcggctacttcacggcgaccgatgcgcatgaaaatgccgatgagcaaatc
attcggctgaaagctgccctcgctgccgagctgccggaatacatggtcccggcgcaactt
ttgcgcctcgacgaaatgccgctgagtcccagcggcaaactcgaccgccgcgccttgccc
gagccgcaatggcaggtgcgtgaacacgtcgaaccggtcagcgaactggagcaacaaatc
gccgcgatctggcacgaagtgctcggtctgaagcagatcggcctgcgcgacgatttcttc
gcgctcggcggtcactcgctactggccacgcaaatcatttcgcgcacacgtcaggcctgt
gacgtcgaactgccgctgcgcacattgttcgagcacagcgaactgggcgattacgccgaa
cagattcgcctgatccaggtcagcggccgcaccaaccaacagttgccgatcgcaaaaatc
gaccgcagccaagcggtgccgctgtcctattcgcagcagcgcatgtggttcctctggcag
atggaaccggacagcccggcttacaacgtcggcggcatggcgcgcttgcgcggcgtgctg
catgtcgagcatttcgaggcggcgttgcaggcgctgatcctgcgccacgaaaccctgcgc
accacattcccaagtgtcgatggcgtcgcccgccaacaggtgcatgccgagaccggcgtg
cgcatgggctggaaggatttctccagcctgccggcagaagtccgggagctacaagtccag
caactggccgatgcagaagcgcaccagccgttcaatctggaaaccggaccgctgctgcgc
gcctgcctggtcaagactgccgaacacgagcattacttcgtcctgaccttgcaccacatc
gtcaccgaaggctgggcgatggacatctttgcccgtgaactcagcgcgctgtatgaagcg
ttcgtcgatgagcgcgcctcgccgcttgagccgctgccggtgcaatacctcgactacagc
gtctggcagcgcaactggctggagtccggcgagcgccagcgccagctcgattactggacc
gcgcagctcggtcgcgaacatccgctcctcgaactgcccggcgaccgtccgcgtccaccg
gtacagagccatcagggcgagctgttccgtttcgatctgagcgacgatctcgccgcgcgg
gtgcgggcgttcaacgcgcaaaacggtctgaccctgttcatgaccatgaccgccgcgctc
gccacgttgctctaccgctatagcggccagaccgacctgcgcatcggcgcgccggtggcc
aaccgcatccgcccggagagtgaagggctgatcggggcgtttctcaacacccaggtgctg
cgttgccggctcgacgggcagatgtcggtcggcgaactgttcgagcaggtgcgccacacc
gtgatcgaaggccagtcccatcaggatctgccgttcgatcatctggtcgaagccttgcag
ccgccacgcagcgcggcttacaacccgctgttccaggtgatgtgcaacgtgcagcgctgg
gaattccagcagagccgcacgctcgctgggatgactgtcgagtacctggccaacgatgcg
cgggcgaccaagttcgatctcaatctggaagtcaccgacctcgaccatcgcctcggctgc
tgcctgacttacagcaccgatctgttcgacgaaccgaccatcgcgcgcatggccaggcat
tggcgcaacctgcttgaagcgttgatcgctgatccgcagcaacgcctcagtgaactgccg
ttgctcgataagtctgagcaacagcagctgctcgacagcctcggcatcgagccgggcgag
catcgtctcgaccagtgcatccatcatctgtttgccgaacaggcgctggcgcgcaaagac
gcgccggcgctgaccttcgccgggcagaccctgagctacgccgaactcgatgcccgggcc
aatcgtctggcctgggcgctgcgtgaacgcggggtcggcccgcaagtgcgggtgggtctg
gcgctggagcgttcgctggaaatggtcatcggcctgctggcgattctcaaggcgggcggc
gcctatgtgccgctggatccggaatacccgctcgaccgcctgcattacatgatcgaagac
agtcgcgtcggcctgctgctcagcgatcgggcgatgttcgaagccctcggtgagttgccg
ccaagcgtggcgcgctggtgtctggaagatgatagcgccgggttggccgactacccggcc
agcgagttgccgtttatcagcctgccgcaacatcaggcctacctgatttatacctctggc
tcgaccggcaagccgaaaggcgtggtggtctcccacggcgaaatcgccatgcactgccaa
gccgtgatcgaacgcttcggcatgcgcccggacgactgtgaactgcatttctattcgatc
aacttcgacgctgccaccgaacgtctactggtgccgctgctcagcggtgcgcaggtggtg
ttgcgggcgcagggccagtgggacgcggaagaaatctgcggcttgattcgtgcgcatcga
atcaacgtcctcggtttcacgccgagctacggcagccagttggcgcagttcctcgcgacc
caaaatgaagtcctgccggttcgcatgatcatcaccggcggtgaagcgctcaccggcgag
catctgcagcgcattcgcgcggcattccaaccggcgcagtttttcaatgcttacggcccg
accgaaaccgtggtcatgccgctggccagtctggcgccgcaggtgctggaagagggcgcc
ggcagtgtgccgatcggcagcgtgatcggggcgcgggtcgcctacattctcgacgccgat
ctggccttggtgccgcaaggtgcgaccggtgaattgtttgtcggtggcgccggtctggcc
caggcctatcacgaccgtccgggcatcagcgccgagcgttttgtcgctgacccgtttgcc
gctgatggcggacgcatgtatcgcaccggcgatttggtgcgccagcgtgccgatggtctg
gtcgagtatctggggcggatcgaccatcaagtgaaaatccgtggcttccgcatcgaactg
ggcgaaatcgaaacgcgcctgctcgatcacccttcgatccgcgaagcggtggtgctggct
ctggacgcaccgagtggcaagcaactggtgggctacctggtgaccgaagtagccgagcga
aatgaggtgcaacaagcggagctgcgcgaagcgctcaagtcgcacctcaaggcgcaactg
ccggattacatggtgccgactcacctgctgctgctggcgagcatgccgctgaccgccaac
ggcaaactcgaccgccgcgccttgccggcgccggatctggagctcaatcgtcaggactat
gtcgcaccgagcaacgccttggaacagaccctggcgcagatctggtgcgatgtgctcaac
gtcaggcaggtcggcctcaacgataacttcttcgaactcggcggcgactcgattctgtcg
attcaggtggtcagccgcgcgcgtcagcagggcattcatttcagcccgcgcgacctgttc
cagcaccagaccgtgcagaccctcgccgcagtcgccagccgcaccgagcaggtgatggcc
gagcagggcctggtggatggcgaatcgcgcctgacaccgattcagcactggttcttcgat
acggacattccccagcgtcagcactggaatcaggcgctgttgctggaaccgactgcgcgc
cttgagccgcaacgattgcagcaagctttgcaggcggtgatcgaacagcacgatgcgctg
cgtctgcgtttcactgaaaccgatgatgcatggcaagcgacgcatcaagcgctgacgaat
gaggatgtgctctggcaagtcagcgtcgattcgctggatcagtgcgaagccctgttcgcc
gacgcgcaacgcagtctgcatctgcacaacggcccgttgctgcgcgcagtgctggtcgat
gtagcggatgttcagcaacgcctgttcatcgccatccaccacttggtggtcgacggtgtt
tcctggcgcgtgctgctcgacgatctgcaaaccgcgtatcgccagctcgacgctgcgcag
ccgctgaaactgccggcgaaaaccagcgccttcaaggactgggccgcgcgtttgcaggct
tatgccggcagcgaatccctgcgtgaagaactcggttggtggcaaacgcaactggccggg
ccaagcgctgatctgccttgcgaaaacccgcagggcggcaggcagaatcgccatgcgcaa
accgtcagcgtacgcctcgatgccgagcgcacccggcagttgctgcaacaggcaccgagc
gcttaccgcacccaggtcaacgacctgctgctgaccgcgctggcccgtgtgctgtgccgc
tggagcggccagccctcggcactgattcaactggaaggccacggtcgcgaaaccctgttc
gacgagatcgatctgacccgcaccgtcggttggttcaccagcgcttatccgctgcgcctg
actccgcacaatgtcgaagaggccgccgggcagggcgcttcgatcaaggcgatcaaagaa
caattgcgcgccgtgccgcacaaaggtctcggttatggcgtgttgcgttatctggccgat
gacggctgccgccagagcatggccgcgctgccacaggcgccgatcacctttaactacctc
ggccagttcgaccagagcttcggcagcgatgcgctgttccgtccgctggatgagccaatc
ggtgcagcccacgatccgcaggcgccgttgcccaacgagctgagtgtcgacagtcagatt
tacggtggtgaactgctgctgcgctggacgttcagtgccgagcgttacgaggcgcaaacc
attaacgatctggccgatgcctatctcggtgagttgcaaagcctgatcgcccattgtctg
caagagggcgccggcggcctgacgccatcggactttccgctggccagactgactcaggcg
caactcgatgcgctgccggtaccggccgcgcacatcgaagatgtctatccgctgacgccg
atgcaggaaggcatgctcctgcacaccctgctggaaccgggcaccggtctgtactacatg
caggatcgatatcgcatcaacagcgagctcgaccccgagcgtttcgcccaggcctggcaa
gcggtggtcgctcgtcatgaagcattgcgcgcttcgttctgctggaacgttggcgaagac
atgctgcaagtgattcacacgccggggcgcacgccgatcgagtatctggactggagcgcc
gtcgccgaaaccgagcaggaaccgaaactgcaagcgctgctgaaaagcgagcgcgaagcc
ggcttcgatctgctcaatcaggcgccgtttcacctgcgcctgatcaaggtcggcgcggcg
cgttactggttcatgatgagcaaccaccacatcctcatcgacgcctggtgccgttcgctg
ctgatgaacgacttcttcgagatctataccgccctcggtgaaggtcgtgaagcgcagttg
agcgtgccgccgcgttatcgcgattacatcggctggctgcaacgccagagcctggccgag
gcgcggcagtggtggcggcagaacctgcaaggctttgagcgcaccacgccgatcccgagc
gaccggccgttcctgcgcgaacatgccggtgaaagcggcggcatgatcgtcggcgaccgt
tacacccgcctcaatgtcgaggacggtgcacggctgcgggaactggcgcaggcacatcaa
ctgaccgtcaacaccttcgcccaggctgcatgggctctggttttgcggcgtctgagcggc
gatcgcgacgtgctcttcggcgtgactgtggccgggcgtccggtggagatgccggaaatg
cagcgcactgtcggcctgttcatcaacagcattgcgctgcgggtgaagatgcccgaggac
gatcagcgcagcagcgtgcgtcaatggctcagcgctttgctcgacagcaacatgcaactg
cgcgagtacgaatacctgccgctggtgaatatccaggaacagagcgaattgcccaaaggc
cagccgctgttcgacagcctctttgtcttcgaaaacgccccggtggaagtctcggtgctt
gatcgtgcacagagcctgaatgcgagctcggattccggccgcacccataccaacttcccg
ctgaccgcggtgtgctacccgggcgatgaccttggcttgcacctgtcctatgaccagcgt
tacttcgacgaggcgacggtcgagcgcatgctcagtgagttcaagcgcctgctgctggca
ctggtcgacggcttccatggcgatatggccgatttgccgctgctaggcgacgaagaacgc
gatttcctgctacacggttgcaaccagagcggccatgactatccgctggagcaaagctac
gtggcgttgttcgaagcgcaggttgaagcgcatccgcagcgcatcgccgccagttgcctc
gatcagcaggtgagctatgccgaactgaatcacaacgccaaccgcctcggccatgccctg
gtcgctgccggcgtgcgcatggatcaaccggtggcgctgctggccgagcgtaatctcgac
ctgctcggcatgatcatcggcagcttcaaggccggcgctggttatctgccgctggatccg
ggcctgccgagccagcgtctgagtcgcatcattgagctgagccgcacgccgttgctggtg
tgcagcgccgcttgccgtgaacaggcgcagaccctgctcgaggagtttggctgttcgaat
cgtccacgcctgctggtgtgggaagaggtgcaagcgtcggcggcagcgacgcacaatccg
ggcatccacagtggctcggataatctcgcctatgtgatttacacctctggttcgaccggg
ctgcctaaaggcgtgatggtcgagcagcgcggcatgctcaacaaccagttgagcaaacgt
ccgtacctcgacttgagcgaggccgatgtgattgcgcagaccgcctcgcaaagcttcgac
atttccgtctggcagttcctcgccgcgccattgttcggcgcgcgggtcgacatcgtgccg
aacgcgattgcccacgatccgcaaggtctgctggcgcatgtgcaggcgcagggcatcacc
gtgctggagagtgtgccgtcgctgattcagggcatgctcggctccgagcgtctgagtctc
gacggcttgcgctggatgctgccgaccggtgaagcgatgccgccggaactggcccatcaa
tggctgctgcgttacccggatattggtctggtcaatgcttacggcccggcggaatgctcg
gatgacgtggcgttcttccgtgtcgacatggcctcgacgcgcggcagttacttgccgatc
ggcacgccgaccgacaataacttgctgtatctgctcgatggcgcgctggatctggtgcct
ttgggcgcggtgggtgagttatgtgttgccgggaccggcgtcggtcgcggttacgtcagc
gatccgctgcgcaccgcgccggtgtttgtgccgaatccgttcggcgcgccgggcgagcgc
ttgtaccgcaccggtgacctggcgcggcgccgcgcggacggcgtactggaatacgtcggc
cgcgtcgatcatcaggtgaagattcgcggctaccgcatcgaactcggtgaaatcgaagcg
cgcctgcatgaacaaccggaagtgcgtgacgctgcggttggtgtgcaggagggcgtcaac
ggcaagcatctggtcggttatctggtcgcggccgatgcagcgctcaatccgggcgaacgc
ctggagcggatcaagcaacgcctgcgcgccgaactccccgaatacatggtgccgctgcac
tggctatggctggagcagatgccgctcaatgccaacggcaaactcgaccgcaaagccttg
ccggccttggagatcggtcagttgcagagcgaggattatctggccccgcgcaacgagctg
gagcagaccctggctgatatctgggctgaggtgctgaaagtggaaaaggttggcctgcgc
gacaacttcttcgaactgggcgggcattcgttgctggctacgcagatcgcttcgcgggta
caaaaagccctgcaacgcaatgtgccgctgcgcgcgatgttcgaatgcagcacggtggag
gaactggccaaatacatcgatgggctggcggccagtgatattacggaggagaaggttgat
cggttgaatgatctgatggcggagctggaggggctgtag

DBGET integrated database retrieval system