KEGG   Pseudomonas koreensis: AYO71_26685Help
Entry
AYO71_26685       CDS       T04647                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
pkr  Pseudomonas koreensis
Pathway
pkr00550  Peptidoglycan biosynthesis
pkr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYO71_26685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pkr01002]
    AYO71_26685
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pkr01011]
    AYO71_26685
Enzymes [BR:pkr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AYO71_26685
Peptidases [BR:pkr01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AYO71_26685
Peptidoglycan biosynthesis and degradation proteins [BR:pkr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AYO71_26685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AMT90970
UniProt: A0A142NI97
LinkDB All DBs
Position
complement(5933464..5934621)
Genome map
AA seq 385 aa AA seqDB search
MNITTFAKRLCLLVPLLLSPAAFAAEMMPSPPQLAAKAYVLMDASSGNVLVENNGDQRLP
PASLTKLMTAYIATLEIRRGQIGENDPVTVSENAWRTGGSRMFIKVGSQVTVSDLLHGII
IQSGNDASVALAEHIAGSEDAFADLMNKTVTELGMTNTHFMNPTGLPNPEHYSSAHDMAI
LARAIIHEDPAHYAIYSQKEFFWNGIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCMVSSA
VRDGQRLIAVVFGTNSEVARAAETQKLLTYGFRFFETQTFYQKGTELAQAPVWKGTTSQV
KAGLAQDLTMTLPKGQLKKLAASMTMNPQLVAPIAKGDVIGKVEVKLEDKVVHSADLIAL
DGVEEGGIFRRMWDSIRLFFYGLFN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccacctttgccaaacgcctgtgtctgctagtcccgctgctcctctcgcca
gccgccttcgcggccgagatgatgccgtcgccaccacaactggccgccaaggcctatgtt
ctgatggacgccagcagcggcaacgtgctggtcgaaaacaacggcgaccagcgtctgcca
ccggccagcctgaccaagctgatgaccgcgtacatcgcgaccctggaaatccgtcgcggc
cagatcggtgaaaacgatccggtgaccgtcagcgaaaacgcctggcgcaccggcggttcg
cggatgttcatcaaggtcggttcgcaggtcactgtcagcgacctgctgcacggcatcatc
atccagtccggtaacgacgccagcgtcgccctggccgagcacatcgccggcagcgaagat
gcgttcgccgatctgatgaacaagaccgtcaccgaactgggcatgaccaatacccacttc
atgaacccgaccggtctgccaaaccctgagcactactcgtcggcgcacgacatggcgatc
ctggcccgtgcgatcatccacgaagacccggctcactatgcgatctactcgcagaaagag
ttcttctggaacggcatcaagcagcctaaccgcaacctgctgctgtggcgcgacaagacc
gttgacggtctgaaaaccggccacaccgatgaagccggctactgcatggtgtcctcggcg
gtacgtgacggccagcgcctgatcgccgtggtgttcggcaccaacagcgaagtggcccgc
gcggctgaaacccagaagctgctgacctacggtttccgcttcttcgaaacccagaccttc
taccagaagggcactgaactggcgcaggcgccggtatggaaaggcaccaccagccaggtc
aaggccggcctggcgcaagacctgaccatgactctgccaaaaggccagctgaagaagctc
gctgccagcatgaccatgaacccgcaactggttgcgccaatcgccaagggcgacgtgatc
ggtaaagtcgaagtcaaactggaagacaaggtggtgcacagcgctgacctgatcgctctg
gacggcgtcgaggagggtggtatcttccgccgcatgtgggatagcatccgtctattcttc
tacggcttgttcaactga

DBGET integrated database retrieval system