KEGG   Paucibacter sp. KCTC 42545: AT984_03860Help
Entry
AT984_03860       CDS       T04227                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pkt  Paucibacter sp. KCTC 42545
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT984_03860
Enzymes [BR:pkt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AT984_03860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin FAD_binding_3 HI0933_like DAO NAD_binding_8 Thi4 AlaDh_PNT_C K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: ALT76471
UniProt: A0A0U3ERI3
LinkDB All DBs
Position
880310..881863
Genome map
AA seq 517 aa AA seqDB search
MLDDTLKTQLKAYLERVTQPFEIKASLNEGSSASEMLGLLQDIASMSDKITLTTDGQDAR
KPSFSLQRSGNDMSLRFAAIPMGHEFTSLVLALLWVGGHPPKVEPEVIEQIKALDGDYRF
EVYMSLSCHNCPDVVQALALMAVLNPRVQTVIIDGALYQDEVNAREIMAVPSVYLNGEVF
GSGRMTVEEIVAKLDTGAAARDAAKLSAKPAFDVLIVGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVNDTLAIENYISVLETDGPKFAAALESHVKAYDVDIMNLQRAEALIPAAAPGE
LIEVKLANGGSLKSKTVILSTGARWRNVNVPGEVEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVSLLEFGDALRADAVLVNKLKSLPNVSIHTSAQTTEFTGAE
GKLNGLSYTDRISGAAHHIELEGVFVQIGLVPNTEWLKGVVELSKHGEIIVDAKGQTSLP
GVFAAGDVTTVPFKQIVIAAGDGAKAALGAFDHLMRN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaccctgaagacccagctcaaggcctatcttgagcgcgtcacccagccg
tttgaaatcaaggcctcgttgaacgaaggcagcagtgccagcgaaatgctgggcttgttg
caagacatcgcctcgatgtccgacaagatcacgctgacgaccgacgggcaagacgcccgc
aagccttccttcagcctgcagcgcagcggcaacgacatgagcctgcgctttgctgccatt
cccatgggccatgagttcacctccctggtgctggccctgctgtgggtgggcggccacccg
cccaaggttgagcccgaagtgattgagcagatcaaggccctggacggcgactaccgcttc
gaggtctatatgtccctgagctgccataactgcccggacgtggtgcaggctttggcgctg
atggccgtgctgaacccgcgcgtgcaaaccgtcatcatcgacggcgccctgtaccaagac
gaagttaacgcccgcgagatcatggccgtgccttcggtctatctgaatggcgaagtgttt
ggctctggccgcatgacggtggaagaaatcgtcgccaagctggacaccggtgctgcggcg
cgtgacgcggccaagctcagcgctaagccggcgtttgatgtgctgatcgtgggcggcggc
ccggccggcgctgcggcagccgtgtacgcggcccgcaagggcattcgcaccggcgtggca
gccgagcgtttcggcggccaggtcaatgacaccttggcgatcgagaactacatctcggtg
ctggagaccgatgggccgaagttcgccgcggcgctggagtcgcatgtcaaagcctacgac
gttgacatcatgaatctgcagcgcgccgaagcgctgatccccgcggccgcgcccggcgag
ctgatcgaggtgaaactggctaacggcggctcactcaagagcaaaaccgtcatcctctct
accggcgcacgctggaggaatgtcaatgtgcccggcgaggtcgagtacaaaaacaagggc
gtggcctactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggctgtgatt
ggcggcggcaactccggcgttgaggcggctatcgacctggccggcatcgtggcccatgtc
agcctgctggaattcggcgatgccttgcgagccgatgcggtgctggtcaacaagctcaag
agcctgcccaatgtcagcatccacaccagcgcccaaacgactgagttcaccggtgccgag
ggcaagctcaatggcctgagctacaccgaccgcatcagcggcgcggcgcatcacatcgaa
ctggaaggtgtgttcgtgcagatcggcttggtgcccaataccgagtggctcaagggcgtg
gtggagttgtcaaagcacggcgagatcatcgttgacgccaagggtcagacctcgctgccc
ggcgtgttcgctgcgggtgacgtgaccaccgtgcctttcaagcaaatcgtcattgccgct
ggtgatggcgccaaggccgcgctgggcgctttcgaccacttgatgcgcaactaa

DBGET integrated database retrieval system