KEGG   Paucibacter sp. KCTC 42545: AT984_06445Help
Entry
AT984_06445       CDS       T04227                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00290  Valine, leucine and isoleucine biosynthesis
pkt00770  Pantothenate and CoA biosynthesis
pkt01100  Metabolic pathways
pkt01110  Biosynthesis of secondary metabolites
pkt01130  Biosynthesis of antibiotics
pkt01210  2-Oxocarboxylic acid metabolism
pkt01230  Biosynthesis of amino acids
Module
pkt_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pkt_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AT984_06445
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT984_06445
Enzymes [BR:pkt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     AT984_06445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ALT76885
UniProt: A0A0U2T9P3
LinkDB All DBs
Position
complement(1455812..1457500)
Genome map
AA seq 562 aa AA seqDB search
MSSTPANRRSKNITEGVARAPNRSMYYGMGYQESDFGKPMIGVANGHSTITPCNSGLQKL
ADAAVIGLKEAGANPQIFGTPTISDGMAMGTEGMKYSLVSREVISDCVETCVGGQWMDGV
IVIGGCDKNMPGGMMGMLRANVPSLYVYGGTILPGKHKGQDLNIVSVFEAVGQFSAGKMS
EEDFCAIERKAIPGSGSCGGMYTANTMSSSFEALGMSLPYSSTMANVEDEVVQSVKKAAA
VLVEAVKADLKPRDIVTKQAIENAVAVIMATGGSTNAVLHFLAIAHAAEVDWTIDDFERV
RRRTPVLCDLKPSGQFLAIDLHHAGGIPAVMKELLKHGLLHGDAMTITGKTVAENLADVP
ELRADQTVIRPVTNPIYAEGHLAILKGNLSPEGCVAKITGLKNPVMSGPARVFEDEQSAL
AAIMAGKIVAGDVMVLRYLGPKGGPGMPEMLAPTGALIGQGLGESVGLITDGRFSGGTWG
MVVGHVAPEAYEGGVIALVKEGDRITIDAHQLLLELHVDAAELATRKAAWVKPAPRYTRG
VLAKFAKNASSASSGAVLDKFE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacccccgccaatcgccgatccaagaacatcaccgagggcgttgcccgcgcc
ccgaaccgctccatgtactacggcatgggctatcaggaaagtgacttcggcaagccgatg
atcggcgtggccaacggccactccaccatcacgccttgcaactccggtctgcaaaagctg
gccgatgcggccgtgatcggcctgaaagaggccggcgccaacccgcagatcttcggcacg
cccaccatcagcgacggcatggccatgggcaccgagggcatgaagtacagcctggtctcg
cgtgaggtgatttccgattgcgtggagacctgcgtcggcggtcagtggatggacggcgtc
atcgtcatcggcggctgcgacaaaaacatgcccggcggcatgatgggcatgctgcgcgcc
aatgtgccctcgctgtatgtctacggcggcaccatcctgccaggcaagcacaagggccag
gatctgaacatcgtcagcgtctttgaagccgtgggccaattcagcgccggcaagatgagc
gaagaagacttctgcgccatcgagcgcaaggccattcccggcagcggctcctgcggcggc
atgtacaccgccaacaccatgagctcctcctttgaggccctgggcatgagcctgccctac
tcctcgaccatggccaatgtcgaagacgaggtggtgcaaagcgtcaagaaggcagctgcc
gtgctggtcgaagccgtcaaggccgacctgaagccgcgcgacatcgtcaccaagcaggcg
atcgagaacgccgtggccgtcatcatggccaccggcggctccaccaatgcggtgctgcac
ttcctggccattgcccatgcggccgaggtggactggaccatcgacgacttcgagcgtgtg
cgtcgccgcacgccggtgctgtgcgacctgaagcccagcggtcagttcctggcgattgat
ctgcaccacgccggcggcatccccgcagtgatgaaggagttgctcaagcacggcctgctg
catggcgacgccatgaccatcaccggcaagaccgtggcagagaacctggccgatgtgccc
gagctgcgagccgatcaaaccgtgatccgcccggtgacgaaccccatctacgccgaaggc
catctggccatcctgaagggcaatctttcccccgagggctgtgtggccaagatcaccggc
ctgaagaacccggtgatgagcggcccggcgcgggtgttcgaagacgagcaatcggccctg
gccgccatcatggccggcaagatcgtcgccggtgacgtcatggtgctgcgttacttgggc
cccaagggcggcccaggcatgcccgaaatgttggcccccaccggcgccctgatcggccaa
ggcctgggcgaaagcgtgggcctgattaccgacggccgcttctccggcggcacctggggc
atggtggtcggtcatgtggcgcccgaggcctatgaaggcggcgtgatcgcgctggtgaag
gaaggcgaccgcatcaccatcgacgcccatcagctgctgctggagttgcatgtcgatgcg
gccgagttggccacccgcaaggccgcctgggtcaagcccgcgccgcgctacacccgtggc
gtgctggccaagttcgcgaagaacgcctccagcgccagttcaggcgcggtgttggacaag
ttcgaataa

DBGET integrated database retrieval system