KEGG   Paucibacter sp. KCTC 42545: AT984_12655Help
Entry
AT984_12655       CDS       T04227                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00020  Citrate cycle (TCA cycle)
pkt00310  Lysine degradation
pkt00380  Tryptophan metabolism
pkt01100  Metabolic pathways
pkt01110  Biosynthesis of secondary metabolites
pkt01120  Microbial metabolism in diverse environments
pkt01130  Biosynthesis of antibiotics
pkt01200  Carbon metabolism
Module
pkt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pkt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT984_12655
  09105 Amino acid metabolism
   00310 Lysine degradation
    AT984_12655
   00380 Tryptophan metabolism
    AT984_12655
Enzymes [BR:pkt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AT984_12655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ALT77906
UniProt: A0A0U2VXF5
LinkDB All DBs
Position
complement(2900979..2902235)
Genome map
AA seq 418 aa AA seqDB search
MAIIEVKVPQLSESVSEGTLLTWKKKPGEAVAIDEILVEIETDKVVLEVPAPSAGVMAQI
VKNDGESVASEEVIARIDTEGTAQASPLEVKAVAAAAPAAAAAAAPVAGGKGDVAMPAAA
KILAEKGLSATDVAGSGKDGRVTKGDALAAGAKPAAVPAPVAVAAAPSVAKPLPAVAAPA
AMNLGDRPEQRVPMTRLRARVAERLLQSQATNAILTTFNEVNMAPVMEMRKKFQEKFEKE
HGVKLGFMSFFVKAAVAALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIIRNA
DQLSFADIEKKIAEFGQKAKEGKISLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAILG
VHATKDRAVVENGQVVVRPINYLAMSYDHRIIDGREAVLGLVTMKEALEDPARLLFDI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcatcgaagtcaaagtcccccagctgtctgaatctgtgtccgaaggcacgctg
ctgacctggaagaaaaaacccggcgaagccgtggccattgacgagatcctggttgaaatc
gagaccgacaaggtcgtgctggaagtgcccgcgccgagcgccggcgtgatggcccagatc
gtcaagaacgacggcgaaagcgtcgccagcgaagaagtcatcgcccgcatcgacaccgaa
ggcacggcccaggccagcccgctggaagtcaaggctgtcgcagccgccgcgccggctgcc
gctgcagcagctgcacccgttgctggtggcaagggcgatgtcgccatgcctgctgccgcc
aagatcctggctgaaaagggcttgtccgccaccgacgtggctggttccggcaaagacggc
cgtgtcaccaagggcgacgccctggccgctggcgccaagccggctgctgtgcccgcaccg
gtggccgtggctgctgcaccctcggttgccaagcctctgcctgctgtggccgcacctgcc
gccatgaacttgggcgaccgccccgagcagcgcgtgcccatgacccgtctgcgcgcccgc
gttgccgagcgtctgctgcaatcgcaagccaccaacgccatcctgaccacgttcaatgaa
gtgaacatggccccggtgatggaaatgcgcaagaagttccaggaaaagttcgagaaggaa
cacggcgtcaagctgggcttcatgagcttcttcgtcaaggccgcggttgccgccctgaag
aagtacccggtgctgaacgcttcggttgacggcaatgacatcgtctaccacggctacttc
gacatcggtatcgccgtcggttcgccgcgcggcctggtggtgcccatcatccgcaatgcc
gaccagctgagctttgccgacattgagaagaagatcgccgaattcggccaaaaggccaag
gaaggcaagatctcgctggacgacctgaccggcggcaccttctccatctccaacggcggc
accttcggctccatgctgtcgacccccatcatcaacccgcctcagtcggccatcctgggc
gtgcacgcgaccaaggaccgcgccgtcgtcgagaacggccaagtggtggtgcgcccgatc
aactatctggccatgtcctatgaccaccgcatcatcgacggccgcgaagccgtgctgggt
ctggtgaccatgaaggaagcgctggaagatccggctcgcctgctgttcgacatctaa

DBGET integrated database retrieval system